SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000034815 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000034815
Domain Number 1 Region: 24-185,223-348
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.75e-62
Family FCH domain 0.0022
Further Details:      
 
Domain Number 2 Region: 496-682
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.55e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.0000964
Further Details:      
 
Domain Number 3 Region: 734-789
Classification Level Classification E-value
Superfamily SH3-domain 4.33e-16
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000034815   Gene: ENSCJAG00000018702   Transcript: ENSCJAT00000036768
Sequence length 1074
Comment pep:novel chromosome:C_jacchus3.2.1:19:28251422:28528712:1 gene:ENSCJAG00000018702 transcript:ENSCJAT00000036768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSPAKFKKDKEIIAEYDTQVKEIRAQLTEQMKCLDQQCELRVQLLQDLQDFFRKKAEIE
MDYSRNLEKLAERFLAKTRSTKDQQFKKDQNVLSPVNCWNLLLNQVKRESRDHTTLSDIY
LNNIIPRFVQVSEDSGRLFKKSKEVGQQLQDDLMKVLNELYSVMKTYHMYNADSISAQSK
LKEAEKQEEKQIGKSVKQEDRQTPRSPDSTANVRIEEKHVRRSSVKKIEKMKEKRQAKYT
ENKLKAIKARNEYLLALEATNASVFKYYIHDLSDLIDQCCDLGYHASLNRALRTFLSAEL
NLEQSKHEGLDAIENAVENLDATSDKQRLMEMYNNVFCPPMKFEFQPHMGDMASQLCAQQ
PVQSELVQRCQQLQSRLSTLKIENEEVKKTMEATLQTIQDIVTVEDFDVSDCFQYSNSME
SVKSTVSETFMSKPSIAKRRANQQETEQFYFTKMKEYLEGRNLITKLQAKHDLLQKTLGE
TLNPEKLPCVKIARSSTVRKQDSSQAIPLVVESCIRFISRHGLQHEGIFRVSGSQVEVND
IKNAFERGEDPLAGDQNDHDMDSIAGVLKLYFRGLEHPLFPKDIFHDLMACVTMDNLQER
ALHIRKVLLVLPKTTLIIMRYLFAFLSHLSQFSEENMMDPYNLAICFGPSLMSVPEGHDQ
VSCQAHVNELIKTIIIQHENIFPSPRELEGPVYSRGGSMEDYCDSPHGETTSVEDSTQDV
TAEHHTSDDECEPIEAIAKFDYVGRTARELSFKKGASLLLYQRASDDWWEGRHNGIDGLI
PHQYIVVQDTEDGVVERSSPKSEIEVISEPPEEKVTARAGASCPSGGHVADIYLANINKQ
RKRPESGSIRKTFRSDSHGLSSSLTDSSSPGVGASCRPSSQPIMSQSLPKEGSDKCSISG
HGSLNSISRHSSLKNRLDSPQIRKTATAGRSKSFNNHRPMDPEVIAQDIEATMNSALNEL
RELERQSSVKHTPDVVLDTLEPLKTSPVVAPTSEPSSPLHTQLLKDPEPAFQRSASTAGD
IACAFRPVKSVKMAAPVKPPATRPKPAVFPKTNATSPGVNSSTSPQSTDKSCTV
Download sequence
Identical sequences F7HT87
ENSCJAP00000034815 ENSCJAP00000034824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]