SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000035074 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000035074
Domain Number 1 Region: 445-638
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.32e-49
Family cAMP-binding domain 0.0001
Further Details:      
 
Domain Number 2 Region: 198-443
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.06e-39
Family Voltage-gated potassium channels 0.0057
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000035074
Domain Number - Region: 657-703
Classification Level Classification E-value
Superfamily Tropomyosin 0.0981
Family Tropomyosin 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000035074   Gene: ENSCJAG00000018878   Transcript: ENSCJAT00000037035
Sequence length 729
Comment pep:novel chromosome:C_jacchus3.2.1:3:142805950:142823270:1 gene:ENSCJAG00000018878 transcript:ENSCJAT00000037035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LIFVFFVEMRFPHIAQAALKLLDSRDPPTSTSKSARIIDMKLTMKKNIINTQLSFVNMPN
VIVPDIEKEIRRMENGACSSFSDDDDSASICEESENENPHTRGSSSYKLHRKGGPSQREQ
YLPGAIALFNVNNSSNKDQEPEGKKKKKKEKKSKSGDKNENTKDPEKKKKKKDTEKKKKE
EKSKDKKEEEKKEVVIIDPSGNTYYNWLFCITLPVMYNWTMVIARSCFDELQSDYLEYWI
VLDYVSDIVYLMDMFVRTRTGYLEQGLLVREELKLINKYKSNLQFKLDVLSLIPTDLLYF
KLGWNYPEIRLNRLLRISRMFEFFQRTETRTNYPNIFRISNLVMYIVIIIHWNACVFYSI
SKAIGFGNDTWVYPDINDPEFGRLARKYVYSLYWSTLTLTTIGETPPPVRDSEYVFVVVD
FLIGVLIFATIVGNIGSMISNMNAARAEFQARIDAIKQYMHFRNVSKDMEKRVIKWFDYL
WTNKKTVDEKEVLKYLPDKLRAEIAINVHLDTLKKVRIFADCEAGLLVELVLKLQPQVYS
PGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKAGNRR
TANIKSIGYSDLFCLSKDDLMEALTEYPDAKTMLEEKGRQILMKDGLLDLNIANAGSDPK
DLEEKVTRMEGSVDLLQTRFARILAEYESMQQKLKQRLTKVEKFLKPLIDTEFSSIEGPG
ADSAPIDST
Download sequence
Identical sequences F7I8Y1
ENSCJAP00000035074 ENSCJAP00000035079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]