SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000035511 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000035511
Domain Number 1 Region: 1-83
Classification Level Classification E-value
Superfamily RING/U-box 4.11e-31
Family RING finger domain, C3HC4 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000035511   Gene: ENSCJAG00000019127   Transcript: ENSCJAT00000037504
Sequence length 84
Comment pep:known chromosome:C_jacchus3.2.1:5:131007984:131013086:1 gene:ENSCJAG00000019127 transcript:ENSCJAT00000037504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCI
LKWLHAQQVQQHCPMCRQEWKFKE
Download sequence
Identical sequences A0A0D9S4N1 A0A1U7TQB9 A0A287BFM3 A0A2J8JG11 A0A2J8XZ40 A0A2K5D752 A0A2K5JU95 A0A2K5L2P4 A0A2K5RL12 A0A2K5VIV1 A0A2K5YHF5 A0A2K6KVG2 A0A2K6SS02 F7I8L7 G1RH68 H9FVK9 Q5R8A2 Q9NYG5
ENSCJAP00000035511 ENSP00000339695 ENSP00000376181 ENSP00000458143 ENSP00000458265 ENSP00000458515 ENSP00000459200 ENSP00000460064 ENSP00000460678 ENSP00000461648 ENSP00000463567 ENSP00000463598 ENSP00000463640 ENSP00000464615 001839130|e5g04B1|376.1.1.10|B:1-84 001839157|e5g05B1|376.1.1.10|B:1-84 001871245|e5lcwB1|376.1.1.10|B:1-84 9600.ENSPPYP00000009821 5g04_B 5g05_B 5khr_B 5khu_B 5l9t_B 5l9u_B 5lcw_B ENSP00000339695 ENSP00000376181 ENSP00000458143 ENSP00000458265 ENSP00000458515 ENSP00000459200 ENSP00000460064 ENSP00000460678 ENSP00000461648 ENSP00000463567 ENSP00000463598 ENSP00000463640 ENSP00000464615 ENSPTRP00000016640 ENSCJAP00000035511 HR2947 gi|18777675|ref|NP_057560.8| gi|50409750|ref|NP_001002249.1| gi|50409781|ref|NP_001002247.1| gi|50409789|ref|NP_001002248.1| gi|50409796|ref|NP_001002245.1| gi|50409804|ref|NP_001002246.1| NP_001002245.1.87134 NP_001002245.1.92137 NP_001002246.1.87134 NP_001002246.1.92137 NP_001002247.1.87134 NP_001002247.1.92137 NP_001002248.1.87134 NP_001002248.1.92137 NP_001002249.1.87134 NP_001002249.1.92137 NP_001126166.1.23681 NP_001252748.1.72884 NP_001276343.1.87134 NP_001276343.1.92137 NP_001276344.1.87134 NP_001276344.1.92137 NP_001276345.1.87134 NP_001276345.1.92137 NP_001276346.1.87134 NP_001276346.1.92137 NP_057560.8.87134 NP_057560.8.92137 XP_001165452.1.37143 XP_001165583.1.37143 XP_001165618.1.37143 XP_001165657.1.37143 XP_003282215.1.23891 XP_003282216.1.23891 XP_003282218.1.23891 XP_003282219.1.23891 XP_003282220.1.23891 XP_003282221.1.23891 XP_003315824.1.37143 XP_004040823.1.27298 XP_004040824.1.27298 XP_004040825.1.27298 XP_004040826.1.27298 XP_004040830.1.27298 XP_004709152.1.18182 XP_005585325.1.63531 XP_005585326.1.63531 XP_005585327.1.63531 XP_005585328.1.63531 XP_005585329.1.63531 XP_008011472.1.81039 XP_008011473.1.81039 XP_008011474.1.81039 XP_008011475.1.81039 XP_008058608.1.4292 XP_008996154.1.60252 XP_009250433.1.23681 XP_009250434.1.23681 XP_009250435.1.23681 XP_009250436.1.23681 XP_009250437.1.23681 XP_009250439.1.23681 XP_009250440.1.23681 XP_009431802.1.37143 XP_009431803.1.37143 XP_010340603.1.74449 XP_010352613.1.97406 XP_011817951.1.43180 XP_011851455.1.47321 XP_011851526.1.47321 XP_011921502.1.92194 XP_011921503.1.92194 XP_011921504.1.92194 XP_011921505.1.92194 XP_012308142.1.9421 XP_012308143.1.9421 XP_012308144.1.9421 XP_012359379.1.23891 XP_012359380.1.23891 XP_012359381.1.23891 XP_012359382.1.23891 XP_014197737.1.60992 XP_014976035.1.72884 XP_014976036.1.72884 XP_014976037.1.72884 XP_014976038.1.72884 XP_015293439.1.63531 XP_016786435.1.37143 XP_017380327.1.71028 XP_017380328.1.71028 XP_017734727.1.44346 XP_018881991.1.27298 XP_018881992.1.27298 XP_020922093.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]