SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000035908 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000035908
Domain Number 1 Region: 93-170
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.45e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0000812
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000035908   Gene: ENSCJAG00000019340   Transcript: ENSCJAT00000037920
Sequence length 258
Comment pep:known chromosome:C_jacchus3.2.1:9:70559605:70562341:1 gene:ENSCJAG00000019340 transcript:ENSCJAT00000037920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LALLCPPPFRVDMMDGCQFSPSEYFYDGSCIPSPEGEFGEEFEPRVAAFGVHKAELQGSD
EDEHVRAPTGHHQAGHCLMWACKACKRKSTTMDRRKAATMRERRRLKKVNQAFETLKRCT
TTNPNQRLPKVEILRNAIRYIESLQELLREQVENYYSLPGQSCSEPTSPTSNCSDGMPEC
NSPVWSRKSSTFDSIYCPDVSNVPNPPNKNSLSSLDCLSNIVDRITSSEQPGLPLQDPAS
LSPVASTDSQPATPGNSS
Download sequence
Identical sequences F6SNY9
ENSCJAP00000048696 ENSCJAP00000035908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]