SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000036665 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000036665
Domain Number 1 Region: 3-63
Classification Level Classification E-value
Superfamily RING/U-box 1.41e-17
Family ZZ domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000036665
Domain Number - Region: 76-114
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0423
Family Classic zinc finger, C2H2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000036665   Gene: ENSCJAG00000019735   Transcript: ENSCJAT00000038724
Sequence length 386
Comment pep:known chromosome:C_jacchus3.2.1:14:21512337:21545929:-1 gene:ENSCJAG00000019735 transcript:ENSCJAT00000038724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISFFLGVSCDACLKGNFRGRRYKCLICYDYDLCASCYESGATTTRHTTDHPMQCILTRVD
FDLYYGGEAFSVEQPQSFTCPYCGKMGYTETSLQEHVTSEHAETSTEVICPICAALPGGD
PNHVTDDFAAHLTLEHRAPRDLLLSYDESSGVRHVRRMFHPGRGLGGPRARRSNMHFTSS
STGGLSSSQSSYSPSNREAMDPIAAELLSQLSGVRRSAGGQLNSSGPSASQLQQLQMQLQ
LERQHAQAARQQLETARNATRRTNTSSVTTTITQSTATTNIANTESSQQTLQNSQFLLTR
LNDPKMSETERQSMESERADRSLFVQELLLSTLVREESSSSDEDDRGEMADFGAMGCVDI
MPLDVALENLNLKESNKGNEPPPPPL
Download sequence
Identical sequences F6TB33
ENSCJAP00000036665 ENSCJAP00000036665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]