SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000036676 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000036676
Domain Number 1 Region: 560-643
Classification Level Classification E-value
Superfamily Kix domain of CBP (creb binding protein) 1.44e-36
Family Kix domain of CBP (creb binding protein) 0.00000371
Further Details:      
 
Domain Number 2 Region: 1049-1174
Classification Level Classification E-value
Superfamily Bromodomain 9.68e-36
Family Bromodomain 0.000000486
Further Details:      
 
Domain Number 3 Region: 313-409
Classification Level Classification E-value
Superfamily TAZ domain 4.32e-26
Family TAZ domain 0.00000138
Further Details:      
 
Domain Number 4 Region: 2037-2090
Classification Level Classification E-value
Superfamily Nuclear receptor coactivator interlocking domain 3.22e-25
Family Nuclear receptor coactivator interlocking domain 0.0000839
Further Details:      
 
Domain Number 5 Region: 1676-1723
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000388
Family ZZ domain 0.0000902
Further Details:      
 
Domain Number 6 Region: 1740-1826
Classification Level Classification E-value
Superfamily TAZ domain 0.0000000301
Family TAZ domain 0.0000306
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000036676
Domain Number - Region: 1255-1296
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00393
Family PHD domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000036676   Gene: ENSCJAG00000019712   Transcript: ENSCJAT00000038735
Sequence length 2379
Comment pep:novel chromosome:C_jacchus3.2.1:12:3755674:3888493:-1 gene:ENSCJAG00000019712 transcript:ENSCJAT00000038735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DFGSLFDLENDLPDELIPNGGELGLLTSGNLVPDAASKHKQLSELLRGGSSSSINPGIGN
VSASSPVQQGLGGQAQGQPNSANMSSLGAMGKSPLSQGDSSAPSLPKQAASTSGPTPPAS
QALNPQAQKLATSSPTTSQTGPGICMNANFNQTHPGLLNSNSGHSLMNQASQGQAQVMNG
SLGAAGRGRGAGMPYPTPAMQGATSSVLAETLTQVSPQMAGHAGLNTAQAGGMAKMGITG
NTSPFGQPFSQAGGQPMGATGVNPQLASKQSMVNSLPTFPTDIKNTSVTNVPNMSQMQTT
VGIVPTQAIATGPTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRACSLPHCRTMKNV
LNHMTHCQAGKACQVIVAHCASSRQIISHWKNCTRHDCPVCLPLKNASDKRNQQTILGSP
ASGIQNTIGSVGTGQQNATSLSNPNPIDPSSMQRAYAALGLPYMNQPQTQLQPQVPGQQP
AQPQTHQQMRTLNPLGNNPMTIPAGGITTDQQPPNLISESALPTSLGAANPLMNDGSNSG
SIGTLSTIPTAAPPSSTGVRKGWHEHVTQDLRSHLVHKLVQAIFPTPDPAALKDRRMENL
VAYAKKVEGDMYESANSRDEYYHLLAEKIYKIQKELEEKRRSRLHKQGILGNQPALPAPG
AQPPVIPQAQPVRPPTTIDGPLPLPVNRMQVSQGMNSFNPMSLGNVQLPQAPMGPRTASP
MNHSVQINSMGSVPGMAISPSRMPQPPNMMGAHTNNMMAQAPAQSQFLPQNQFPSSSGAM
SVNSVGMGQPPAQTGVSQGQVPGAALPNPLNMLGPQASQLPCPPVTQSPLHPTPPPASTA
AGMPSLQHPTPPGMTPPQPAAPTQPSTPVSSSGQTPTPTPGSVPSATQTQSTPTVQTAAQ
SQVTPQPQTPAQPPSVATPQSSQQQPTPVHAQPPGTPLSQAAASIDNRVPTPSSVASAET
NSQQPGPDVPVLEMKVEAHTENTEPDPGESKGEPRSEMMEEDLQGASQVKEETDTAEQKS
EPMEVDEKKPEVKVEVKEEEESSTNGTASQSTSPSQPRKKIFKPEELRQALMPTLEALYR
QDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNN
AWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCYGKQLCTIPR
DAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQPQTTISKDQFEKKKNDTLDPEPFVDC
KECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRPRKENKFSAKRLQTTRLGNHLEDRVN
KFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEID
GVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKK
LGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAFAERIIHDYKDIF
KQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKKEESTAASETTEGSQGDSK
NAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDLSQKLYATMEKHKEVFFVIHLHAGPVI
NTLPPIVDPDPLLSCDMDGRDAFLTLARDKHWEFSSLRRSKWSTLCMLVELHTQGQDRFV
YTCNECKHHVETRWHCTVCEDYDLCINCYNTKSHAHKMVKWGLGLDDEGSSQGEPQSKSP
QESRRLSIQRCIQSLVHACQCRNANCSLPSCRDEAGGAAHQGCKRRPMGAARCVAAHRLC
CYHASTARKQMPKNKCPVPFCLNIKHKLRQQQIQHRLQQAQLMRRRMATMNTRNVPQQSL
PSPTSAPPGTPTQQPSTPQTPQPPAQPQPSPVSMSPAGFPSVARTQPPTTVSAGKPTSQV
PAPPPPAQPPPAAVEAARQIEREAQQQQHLYRVNINNGMPPGRTGMGTPGSQMAPVSLNV
PRPNQVSGPVMPSMPPGQWQQAPLPQQQPMPGMPRPVMSMQAQAAVAGPRMPSVQPPRSI
SPSALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAAFIKQRTAKYVATGIHQQPSLQNL
NAMQAGVPRPGVPPQQQAMGGLNPQGQALNIMNPGHNPNMASMNPQYREMLRKGNAGMAG
GMAGHGQFQQPQGPGGYPPAMQQQQRMPQHLPLQGSSIGQMAAQMGQLSQMGQPGMGADS
TPNIQQALQQRILQQQQMKQQIGSPGQPNPMSPQQHMLSGQPQASHLPGQQIATSLSNQV
RSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVTMASSIDQGHLGNP
EQSAMLPQLNTPSRSALSSELSLVGDTTGDTLEKFVEGL
Download sequence
Identical sequences F6T015
ENSCJAP00000036676 ENSCJAP00000036688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]