SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000037201 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000037201
Domain Number 1 Region: 21-302
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.49e-69
Family FCH domain 0.0049
Further Details:      
 
Domain Number 2 Region: 359-422
Classification Level Classification E-value
Superfamily SH3-domain 3.28e-18
Family SH3-domain 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000037201   Gene: ENSCJAG00000019993   Transcript: ENSCJAT00000039287
Sequence length 424
Comment pep:novel chromosome:C_jacchus3.2.1:11:110447699:110455926:-1 gene:ENSCJAG00000019993 transcript:ENSCJAT00000039287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPEEDAGGEALGGSFWEAGNYRRTVQRVEDGHRLCGDLVSCFQERARIEKAYAQQLADW
ARKWRGTVEKGPQYGTLEKAWHAFFTAAERLSAMHLEVREKLQGQDSERVRAWQRGAFHR
PVLGGFRESRAAEDGFRKAQKPWLKRLKEVEASKKSYHASRKDEKTAQTRESHAKADSAI
SQEQLRKLQERVERCAKEAEKTKAQYEQTLAELHRYTPRYMEDMEQAFETCQAAERQRLL
FFKDMLLTLHQHLDLSSSEKFHELHRNLHQSIEAASDEEDLRWWRSTHGPGMAMNWPQFE
EWSLDTQRTISRKEKGGRSPDEVTLTSIMPTRDGTAPPPQSPGSPGTGQDEEWSDEESPR
KAATGVRVRALYDYAGQEADELSFRAGEELLKMSEEDEQGWCQGQLQSGRIGLYPANYVE
CVGA
Download sequence
Identical sequences F6YHC0
ENSCJAP00000037202 ENSCJAP00000037201 XP_003734296.1.60252 XP_009006290.1.60252 XP_009006291.1.60252 XP_009006292.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]