SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000037475 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000037475
Domain Number 1 Region: 1-97
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.38e-23
Family Ribonuclease PH domain 1-like 0.00000214
Further Details:      
 
Domain Number 2 Region: 98-189
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 0.0000000000000468
Family Ribonuclease PH domain 2-like 0.0000434
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000037475   Gene: ENSCJAG00000020152   Transcript: ENSCJAT00000039584
Sequence length 190
Comment pep:novel chromosome:C_jacchus3.2.1:22:34556144:34563810:-1 gene:ENSCJAG00000020152 transcript:ENSCJAT00000039584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGLPGVAEKSRERLIRNTCEAVVLGT
LHPRTSITVVLQVVSDAGSLLACCLNAACMALVDAGVPMRALFCGVTCALDSDGTLVLDP
TSKREKNLTPEALTLSLFLLISKKRLVNLSPQHQPVSPPKLQQCLAAAQAASQHVFRFYR
ESLQRRYSKS
Download sequence
Identical sequences F7BH14
ENSCJAP00000037475 ENSCJAP00000037475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]