SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000037667 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000037667
Domain Number 1 Region: 11-77
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000055
Family HLH, helix-loop-helix DNA-binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000037667   Gene: ENSCJAG00000020264   Transcript: ENSCJAT00000039788
Sequence length 2237
Comment pep:novel chromosome:C_jacchus3.2.1:15:84376918:84397816:-1 gene:ENSCJAG00000020264 transcript:ENSCJAT00000039788 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEMTENETPTKKQHRKKNRETHNAVERHRKKKINAGINRIGELIPCSPALKQSKNMILD
QAFKYITELKRQNDELLLNGGNNEQAEEIKKLRKQLEEIQKENGRYIELLKANDICLYDD
PTIHWKGNLKNSKVSVVIPSDQVQKNIIVYSNGNQPGGNSQGIAVQGVTFNVGPNLQKQT
ASVVPVPRTCNLVTPASISGVYPSENKPWHQTTVPALATNQPVPLCLPATISAQSILELP
TSESESSVLGATGGSLIAVSVGPEPHQHRSLHTCLNDQSSSENKNGQENPKLLKKMSPCT
TNIPLSSSATATEVHHGSKSCLSTQDFRGDVQNTVVVSVTTTVCAQPPRTAGESSPVSIS
KSADSTSTATVVASSAPAVGKATVPVSTLSGNPLDNGWTLSCSLPSSSVSVSDLKNINSL
TRISSAGNTQTTWTTLQLAGNTIHPLSQTPSSAVTPALSESGTSPTTSNHSRHMATGINL
NNSFPADGQPVEQVVVTLPSCPSLPMQPLIAPPQVKSQPPKNILPLNSAMQVIQMAQPVG
SAVNAGPTNQNVIILQPASTTACPTVMRAEVPSQTVGQQIVIIQAANQNPLPLLSAPPPG
SVRLPINGANAVIGSNNSVQNVSTPQTFGGKHLVHILPRPSSLSVSNSTQTFSVTMSSQQ
PQTISLNGQLFALQPVLSSSGTTNQTPMQIIQPTTSEDPNTNVALNTFGALASLNQSISQ
MAGQSCVQLSMSQPANTQTAANSQTTPNCVSLATTAAPPVATDSSATLASTYNLVTPSSV
NTVAGLPPNVKSKRLTKKPGAKKHLAANKSACSLNPVRDVNKLDCPNTEGSAEPPCNDGL
LESLPAVLPSVSVSQANSVSVSASHSLGAVSSESLIPGSASKSKSAEKSSSPSQESVTSE
HFAVAPAKSKDSTPNLQQEMSQGKPPSSSASSDAAKPCTSANVLIPSPSDPHILVSQVSG
LPSTTSTTSTDCVSEVEIIAEPCRVEQDASDTMQTAGLLKGQGLTTLLSDLAKKKDPQKS
SLSDQMDHPDFSSENPKLVDSSVNLQPKQELLLMNNDERDPPQHHPCLPDQEVIHGSLIT
SRQADSPMSTSSGSSRSFSVASMLPETTREDVTSNATTNTCDSCTFVEQTDIVALAARAI
FDQENLEKGRVGLQADIREVASKPSEASSLEGDPPFKSQIPKENGTGQAEATPNEFNSQD
SIEATMERPLEKPSCSLGIKTSNASLQASNPQPPSITSLSVNNLIHQSSVSHPLVSCAGL
SPASEPTTVPATVNLTISSSSYGSQPPGPSLITEYSQEQLNTMTSTIPNSQIQEPLLKPS
HESRKDSAKRAVQDDLLLSSAKRQKHCQPASLRLESMSLMSRTPDTISDQTQMMVSQLPP
NSSNSVVPVSNPAHGDGLTRLFPPANNFVAPALRQSEVQCGSQPSVAEQQQTQASQHLQA
LQQHVPAQGVPHLHSNHLYIKQQQQQQQQQAGQLRERHHLYPMQHHVPHAESSVHSQPHN
VHQQRTLQQEVQMQKKRNLVQGTQASQLSLQAKHHGTDQSRSKSGQPHPHHQQLQQQMQQ
HFGSSQTEKSCENPSATRNHHNRPQNHLNQDIMHQQQEVGSRQQGSGVSSEHVSGHNPMQ
RLLTSRGLEQQMVSQPSIVTRSSDMTCTPHRPERNRVSSYSAEALIGKTSSNSEQRMGIS
IQGSRVSDQLEMRSYLDVPRNKSLAIHNMQGRVDHAVASDIRLSDCQTFKTSGASQQPQS
NFEVQSSRNNEIGNPVSSLRSMQSQAFRISQNTGPPPTDRQKRLPYPPVQTIPTGNGIPS
RDSENACHQSFMQSLLAPHLSDQVIGSQRSLSEHQRNTQCGPSSAIEYNCPPTHENVHIR
RESESQNRESCDMSLGAINTRNSTLNIPFSSSSSSGDIQGRNTSPNVSVQKSNPMRITDS
QATKGHMNPPVTTNMHGVARPALPPPSVSHGNADQGPPVRQANSSVPQRSRHPLQDSSGS
KIRQPERNRSGNQRQSNVFDPSLPHLPLPAGGSMILGRQQPAAEKRGSIVRFMPDSSQVP
NDNPGPDQHTLSQNFGFSFIPEGGMNPPINANASFIPQVTQPSATRTPALIPVDPQNTLP
SFYPPYSPAHPTLSNDISIPYFSNQMFSNPSTEKVNSGSLNNRFGSILSPPRPVGFAQPS
FPLLPDMPPMHMTNSHLSNFNMTSLFPEIATALPDGSAMSPLLTIANSSASDSSKQSSNR
PAHNISHILGHDCSSAV
Download sequence
Identical sequences F6ZEN9
ENSCJAP00000037667 XP_017820736.1.60252 ENSCJAP00000037668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]