SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000037705 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000037705
Domain Number 1 Region: 18-178,220-282
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.64e-68
Family BAR domain 0.0012
Further Details:      
 
Domain Number 2 Region: 300-311,346-403
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000381
Family SH3-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000037705   Gene: ENSCJAG00000020282   Transcript: ENSCJAT00000039827
Sequence length 404
Comment pep:known chromosome:C_jacchus3.2.1:1:172938303:172959643:-1 gene:ENSCJAG00000020282 transcript:ENSCJAT00000039827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFNMKKLASDAGIFFTRAVQFTEEKFGQAEKTELDAHFENLLARADSTKNWTEKILRQT
EVLLQPNPXARVEEFLYEKLDRKVPSRVTNGELLAQYMAEAASELGPTTPYGKTLLKVAE
AEKQLGATERDFIHTASISFLTPLRNFLEGDWKTISKERRLLQNRRLDLDACKARLKKAK
AAEAKATCEGDTVPDFQETRPRNYILSASASALWNDEVDKAEQELRVAQTEFDRQAEVTR
LLLEGISSTHVNHLRCLHEFVKSQTTYYAQCYRHMLDLQKQLGSSQGTIFPGTFVGTTEP
TSPPLSSTSPTTTAATMPVVPSVASLAPPGEASLCLEEVAPPASGTRKARVLYDYEAADS
SELALLADELITVYSLPGMDPDWLIGERGNKKGKVPVTYLELLS
Download sequence
Identical sequences F7GDQ5
ENSCJAP00000048374 ENSCJAP00000037705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]