SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000037807 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000037807
Domain Number 1 Region: 585-665
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000314
Family HLH, helix-loop-helix DNA-binding domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000037807   Gene: ENSCJAG00000020340   Transcript: ENSCJAT00000039933
Sequence length 787
Comment pep:novel chromosome:C_jacchus3.2.1:9:113037330:113040664:1 gene:ENSCJAG00000020340 transcript:ENSCJAT00000039933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPFSGKLVSPKWKNFKGLKLQWRDKIRLNNAIWRAWYMQYLEKRKNPVCHFVTPLDGSVD
VDEHRRPEAITTEGKYWKSRIEIVIREYHKWRTYFKKRLQQHKDEDLSSLAQDYDMLYWH
KHRDGWKTPVPMEEDPLLDTDMLMSEFSDTLFSTLSSHQPVAWPNPREIAHLGNADMIQP
GLMPLQPNLDFMDTFEPFQDLFSSSRSIFGSMLPASASAPVPDPNNPPAQESILPTTTLP
TVSLPDSLIEPHAAPSLDPVDGQGCERASRTEDPFIQPTDFGPSEPPLSVPQPFLPVFTM
PLLSPSPAPPPVSPMLPIVPPPATALNPPAPPAFQQPQKFVGVSKPPSVITHTASATLTH
DASATTFSQSQGLIITTHHPASSVNPCGLTLSPVTRPPQPRLTFVHPKPVSLTGGRPKQP
HKIVPAPKPEPVSLVLKNACIAPAPFSGQPQAVIMTSGPLKREGMLASTVSQSNVVIAPA
AIARAPGVPEFHSSILVTDLGHSTSNPPTPISRLFPSTAQDTLGKAEQVPPHGGSPQVTV
TGPSRDCPNSGQASPCASEQSPSPQSPQNNCSGKSDPKNLAALKNRQMKHISAEQKRRFN
IKMGFDTLNSLISNNSKLTSHAITLQKTVEYITKLQQERGQMQEEARRLREEIEELNATI
ISCQQLLPATGVPVTRRQFDHMRDMFDEYVKNRTLQNWKFWILQFSIIIKPLFESFKGMV
STSSLEELHRTALSWLDQHCSLPILRPMVLNTLRQLSTSTSILTDPAQLPEQASEAITRI
GKRLGES
Download sequence
Identical sequences F7ADE6
ENSCJAP00000037807 ENSCJAP00000037820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]