SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000038152 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000038152
Domain Number 1 Region: 168-291
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.29e-41
Family Eukaryotic type KH-domain (KH-domain type I) 0.000000273
Further Details:      
 
Domain Number 2 Region: 74-166
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.43e-26
Family Cold shock DNA-binding domain-like 0.00000497
Further Details:      
 
Domain Number 3 Region: 25-74
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.00000000000549
Family ECR1 N-terminal domain-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000038152   Gene: ENSCJAG00000020537   Transcript: ENSCJAT00000040309
Sequence length 293
Comment pep:known chromosome:C_jacchus3.2.1:1:174809709:174820997:1 gene:ENSCJAG00000020537 transcript:ENSCJAT00000040309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMEMRLPVARKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSV
ERVNKLICVKALKTRYIGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNLPGGEL
RRRSAEDELAMRGFLQEGDLISAEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVK
RQKTHFHDLPCGASVILGNNGFIWIYPTPEHKEEEAGGFAANLEPVSLADREVISRLRNC
IVSLVTQRMMLYDTSILYCYEASLPHQIKDILKPEIMEEIVMETRQRLLEQEG
Download sequence
Identical sequences F7I4T4
ENSCJAP00000038152 XP_002743446.1.60252 ENSCJAP00000038152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]