SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000038452 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000038452
Domain Number 1 Region: 172-294
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.03e-34
Family YigZ N-terminal domain-like 0.0039
Further Details:      
 
Domain Number 2 Region: 10-115
Classification Level Classification E-value
Superfamily UBC-like 5.77e-25
Family RWD domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000038452   Gene: ENSCJAG00000020674   Transcript: ENSCJAT00000040625
Sequence length 320
Comment pep:known chromosome:C_jacchus3.2.1:13:61840256:61871475:1 gene:ENSCJAG00000020674 transcript:ENSCJAT00000040625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGDAGSDQRQNEEIEAMAAIYGEEWCVIDDCAKIFCIRISDDIDDPKWTLCLQVMLPD
EYPGTAPPIYQLNAPWLKGQERADLSNSLEEIYIQNIGESILYLWVEKIRDVLIQKSQMT
EPGPEVKKKTEEEDVECEDDIILACQPESSVKALDFDISENRTVLEVEELPPIDHGIPIT
DRRSTFQAHLAPVVCPKQVKMVLSKLYENKKIASATHNIYAYRIYCEDKQTFLQDCEDDG
ETAAGGRLLHLMEILNVKNVMVVVSRWYGGILLGPDRFKHINNCARNILVEKNYTNSPEE
SSKSLGKNKKVRKDKKRNDH
Download sequence
Identical sequences F7IT46
ENSCJAP00000038452 ENSCJAP00000038452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]