SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000038478 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000038478
Domain Number 1 Region: 436-532
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.42e-25
Family SPRY domain 0.00084
Further Details:      
 
Domain Number 2 Region: 6-80
Classification Level Classification E-value
Superfamily RING/U-box 1.06e-20
Family RING finger domain, C3HC4 0.0076
Further Details:      
 
Domain Number 3 Region: 306-378
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.1e-19
Family SPRY domain 0.0032
Further Details:      
 
Domain Number 4 Region: 96-157
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000336
Family B-box zinc-binding domain 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000038478
Domain Number - Region: 384-431
Classification Level Classification E-value
Superfamily ARM repeat 0.000691
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000038478   Gene: ENSCJAG00000020693   Transcript: ENSCJAT00000040653
Sequence length 539
Comment pep:novel chromosome:C_jacchus3.2.1:4:30515591:30533876:-1 gene:ENSCJAG00000020693 transcript:ENSCJAT00000040653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSAPLRSLEEEVTCSICLDYLRDPVTIDCGHVFCRSCTTDVRPISGSRPVCPLCKKPF
KKENIRPVWQLASLVENIERLKVDKGRQPGEVTREQQDAKLCERHREKLHYYCEDDGKLL
CVMCRESREHRPHTAVLMEKAAQPHREKILNHLSTLRRDRDKIQGFQAKGEGDILAALKK
LQDQRQYIVAEFEQGHQFLREREQHLLEQLAKLEQELTEGREKFKSRGVGELARLALVIS
ELEGKAQQPAAELMQDTRDFLNRYPRKKFWVGKPIARVVKKKTGEFSDKLLSLQRGLREF
QGKLLRDLEYKTVSVTLDPQSASGYLQLSEDWKCVTYTSLYKCAYLHPQQFDCEPGVLGS
KGFTWGKVYWEVEVEREGWSEDEEEGEEEEEGEEEEEEEEAGYGDGYDDWETDEDEESLG
DEEEEEEDEEEEVLESCMVGVARDSMKRKGDLSLRPEDGVWALRLSSSGIWANTSPEAEL
FPALRPRRVGIALDYEGGTVTFTNAESQELIYTFTATFTRRLVPFLWLKWPGTRLLLRP
Download sequence
Identical sequences A0A2K5CWX5 F7INH8
ENSCJAP00000038481 ENSCJAP00000045852 XP_002746339.1.60252 XP_012332512.1.9421 XP_012332513.1.9421 ENSCJAP00000038478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]