SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000038492 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000038492
Domain Number 1 Region: 6-62
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000181
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Domain Number 2 Region: 68-116
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000519
Family B-box zinc-binding domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000038492   Gene: ENSCJAG00000020702   Transcript: ENSCJAT00000040667
Sequence length 252
Comment pep:novel chromosome:C_jacchus3.2.1:4:30459454:30475991:1 gene:ENSCJAG00000020702 transcript:ENSCJAT00000040667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPLHKDTQEEGVCPICQESLKEAMSTKCGHLFCRVCLKQHVEKASASGVICCPLCRKPC
SEEVLGTGYICLNHQKRVCRFCEESRLLLCLECLVSPEHTSHHELTIENALSHYKVSPDP
APAPLRCCILHVHHAWHLRIARQRTPLFFQVDYGNHRLESQHQTREQLDALPQQQPGQLE
HMPAEVARISKAVTQLSSLVIDLERMAKELDTNTLKNAGDLLNRSAPQKLEVIYPQLGKR
VNELLLQPSSEA
Download sequence
Identical sequences F7F929
ENSCJAP00000048553 ENSCJAP00000038492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]