SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000039257 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000039257
Domain Number 1 Region: 247-341
Classification Level Classification E-value
Superfamily RING/U-box 5.86e-18
Family U-box 0.0066
Further Details:      
 
Domain Number 2 Region: 478-534
Classification Level Classification E-value
Superfamily RING/U-box 0.000000261
Family RING finger domain, C3HC4 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000039257   Gene: ENSCJAG00000021095   Transcript: ENSCJAT00000041474
Sequence length 541
Comment pep:known chromosome:C_jacchus3.2.1:5:8904713:8918573:-1 gene:ENSCJAG00000021095 transcript:ENSCJAT00000041474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVINLCLPQFRPRIHCNKISADGYEVENLISEDLTKRSHGFRTEYFIKPPVCVTVSFPFN
VEICRINIDLTAGGGQNITGLEMYTSASSSRVSWSTPQCRTPGPAEPSVPDKETFTLVGK
VLLKNQSQVVFSHRGFKARPPFGPMEATLPSPVVVAQELWNKGAVSLSHVAHLRICITHM
TGGGVPCIKRLEVWGQPAKTCSQEVIDSILLVASESLPQDVALQAPALPMESDCDPGDQC
ESQQAPSSLQKLAESIQDVPEEFLDPITLEIMPCPMLLPSGKVIDQSTLEKCNRSEATWG
RVPSDPFTGVAFTPHSQPLPHPSLKARIDHFLLQHSIPGCHLLGRAQTALAVTPSSIVLP
CRKRKIEQTERVPDSNLGINASYFSATSPLILPTTSEHTAKKMKATNEPTLAHMDCSTGP
LSHEQKLSQSLEIALASTLGSMPSFTARLTRGQLQHLGTRGSSASWRPGTSSEQPGSIPG
PECASCKRVFSPYFKKEPVYQLPCGHLLCRPCLGEKQHSLPMTCTTCQRPVASQDVLRVH
F
Download sequence
Identical sequences F7FEQ6
XP_008993910.1.60252 ENSCJAP00000039257 ENSCJAP00000039257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]