SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000039295 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000039295
Domain Number 1 Region: 11-225
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.28e-47
Family DBL homology domain (DH-domain) 0.00028
Further Details:      
 
Domain Number 2 Region: 256-452
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.94e-36
Family BAR domain 0.014
Further Details:      
 
Domain Number 3 Region: 593-672
Classification Level Classification E-value
Superfamily SH3-domain 9.45e-19
Family SH3-domain 0.00063
Further Details:      
 
Domain Number 4 Region: 494-568
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000144
Family SH3-domain 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000039295   Gene: ENSCJAG00000021116   Transcript: ENSCJAT00000041514
Sequence length 675
Comment pep:known chromosome:C_jacchus3.2.1:2:47017795:47081511:1 gene:ENSCJAG00000021116 transcript:ENSCJAT00000041514 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKHGADEPSSRSGSPDGEDRASEDRSLLHQRLAVQELIDTEVSYLHMLHLCASDIRSRL
QQLPQGDLDVLFSNIDDIIKVNSRFLHDLQETASKKEEQVQLVGNLFLEFQEELEQVYKI
YCASYDQALLLVEMYRKEPELQQHIQGIIKAVVPQAGSSGLSFLLVIPLQRITRYPLLLQ
KILENTLPDASAYPVLQRAVSALQDVNTNINEYKMRKEVASKYTKVEQLTLRERLARINT
HTLSKKTTRLSQLLKQEAGLIPRTEDKEFDDLEERFQWVSLCVTELKNNVAAYLDNLQAF
LCFRPHEFNLDIAEGPAVQYCNLARDLQLEAFLKFKQRLEGLVWQPLCSLAKALLGPQNL
IKKRLDKLLDFERVEEKLLEVGSVSYEEQAARHTYQALNSLLVAELPQFNQLAIQWLGQI
LRTFVTLQRDLAKQVLQRAEGSMAQLPHHHVPEPAFRKLVEDTLGRTSNQLHSFQETFEK
VLPPPTTQPLLPGSERQVQALLSRYGPGKLYQVTNNISGTGTLDLTLPRGQVVALLQNKD
TKGNSGRWLVDTGRHRGYVPAGKLQLYHVVPSAEELRRQAGLNEEPRCLTPEPVRAPVPS
IPTVNQVIAAYPFEARSSHEVSLQAGQPVTVLEAQDKKGNPEWSLVEVNGRRGYVPSGFL
ARVPSPVLWGWNLPS
Download sequence
Identical sequences F7EN77
ENSCJAP00000039295 ENSCJAP00000039295 XP_002744405.1.60252 XP_008985938.1.60252 XP_008985944.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]