SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000039527 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000039527
Domain Number 1 Region: 63-127
Classification Level Classification E-value
Superfamily RING/U-box 4.64e-18
Family RING finger domain, C3HC4 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000039527   Gene: ENSCJAG00000021226   Transcript: ENSCJAT00000041757
Sequence length 150
Comment pep:known chromosome:C_jacchus3.2.1:5:9762736:9844466:-1 gene:ENSCJAG00000021226 transcript:ENSCJAT00000041757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSMSSDFPHYNFRMPNIGFQNLPLNIYIVVFGTAIFVFILSLLFCCYLIRLRHQAHKEFY
AYKQVILKEKVKELNLHELCAVCLEDFKPRDELGICPCKHAFHRKCLIKWLEVRKVCPLC
NMPVLQLAQLHSKQDRGPPQGPLPGAENIV
Download sequence
Identical sequences F7DDK8
ENSCJAP00000039527 ENSCJAP00000039527 ENSFCAP00000006927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]