SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000039934 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000039934
Domain Number 1 Region: 8-179
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.81e-41
Family Ribonuclease PH domain 1-like 0.000000148
Further Details:      
 
Domain Number 2 Region: 152-238
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.96e-23
Family Ribonuclease PH domain 2-like 0.00000479
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000039934   Gene: ENSCJAG00000021458   Transcript: ENSCJAT00000042190
Sequence length 245
Comment pep:known chromosome:C_jacchus3.2.1:16:50577629:50579625:-1 gene:ENSCJAG00000021458 transcript:ENSCJAT00000042190 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGLELLSDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHEIRG
SRARALPDRALVNCQYSSATFSTGERKRRPHGDRKSCEMGLQLRQTFEAAILTQLHPRSQ
IDIYVQVLQADGGTYAACVNAATLAVLDAGIPMRDFVCACSAGFVDGTALADLSHVEEAA
GGPQLALALLPASGQIALLEMDARLHEDHLEQVLEAAAQAAQDVHILLDRVVRQHVREAS
ILLGD
Download sequence
Identical sequences F7HJR4
ENSCJAP00000039934 ENSCJAP00000039934 XP_002759197.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]