SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000040618 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000040618
Domain Number - Region: 24-88
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000139
Family Eukaryotic type KH-domain (KH-domain type I) 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000040618   Gene: ENSCJAG00000021934   Transcript: ENSCJAT00000042919
Sequence length 116
Comment pep:known chromosome:C_jacchus3.2.1:14:23987681:23988028:-1 gene:ENSCJAG00000021934 transcript:ENSCJAT00000042919 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTLRERRNIPPWVKCFKDLKDSEVFQVQTRLLEAMFGRDGCRILYIEQVSKAMLELKAL
ESPDFAEVVVYGSYKYKLRAKWLLQSMAEWHRQRQERKMLKLEEAMNALEPASNQD
Download sequence
Identical sequences F7IE49
ENSCJAP00000040618 ENSCJAP00000040618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]