SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000040908 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000040908
Domain Number 1 Region: 39-101
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.09e-20
Family HLH, helix-loop-helix DNA-binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000040908   Gene: ENSCJAG00000022261   Transcript: ENSCJAT00000043246
Sequence length 152
Comment pep:known chromosome:C_jacchus3.2.1:12:56047253:56048744:1 gene:ENSCJAG00000022261 transcript:ENSCJAT00000043246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSCKPSGPPAGARVAPPCAGGAECAGTCAGAGRLESAARRRLAANARERRRMQGLNTAF
DRLRRVVPQWGQDKKLSKYETLQMALSYIMALTRILAEAERFGSERDWVGLHCEHFGRDH
YLPFPGAKLSGESELYGQRLFGFQPEPFQMAT
Download sequence
Identical sequences A0A2K5C3C8 F7I247
ENSCJAP00000040908 XP_009008105.1.60252 XP_009008106.1.60252 XP_012306827.1.9421 XP_017834562.1.60252 XP_017834563.1.60252 ENSCJAP00000040908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]