SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000040954 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000040954
Domain Number 1 Region: 75-124
Classification Level Classification E-value
Superfamily RING/U-box 3.53e-21
Family RING finger domain, C3HC4 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000040954   Gene: ENSCJAG00000022314   Transcript: ENSCJAT00000043299
Sequence length 153
Comment pep:known chromosome:C_jacchus3.2.1:3:4637249:4637710:-1 gene:ENSCJAG00000022314 transcript:ENSCJAT00000043299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASYFDEHDCEPLDPEQETRTNMLLELPRSLFNRMEFEDLGLVVDWDHHLPPPAAKTVVE
NLPRTVIRGSQAELQCPVCLLEFEEEETAIEMPCHHLFHSSCILPWLSKTNSCPLCRHEL
PTDNDTYEEHRRDKARKQQQQQRLENLHGAMYT
Download sequence
Identical sequences F7HUZ4
ENSCJAP00000040954 ENSCJAP00000040954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]