SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000041210 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000041210
Domain Number 1 Region: 157-248
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.75e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000041210   Gene: ENSCJAG00000022611   Transcript: ENSCJAT00000043596
Sequence length 253
Comment pep:novel chromosome:C_jacchus3.2.1:1:63148698:63149896:1 gene:ENSCJAG00000022611 transcript:ENSCJAT00000043596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LESEMEAESTGAEEGFTQVTCKGGRRAKKRQAEQLSAAGEGRDVGLMDTEEARSAKRPVF
PPLCGDGLLTGKEETRKIPVPANRYTPLKENWLKIFTPIVEHLGLQIRFNLKSRNVEIRT
CKETRDVSALTKAADFVKAFILGFQVEDALALIRLDDLFLESFEITVVKPLKGDHLSRAI
GRIAGKGGKNKFTIENVTRTRIVLADVKVHILGSFQNIKMAKTAICNLILGNPPPAKVYG
NIRAVASRSTDRF
Download sequence
Identical sequences F7HAY8
ENSCJAP00000041210 ENSCJAP00000041210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]