SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000042895 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000042895
Domain Number 1 Region: 311-414
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.18e-21
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00058
Further Details:      
 
Domain Number 2 Region: 69-141
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000017
Family HLH, helix-loop-helix DNA-binding domain 0.0032
Further Details:      
 
Domain Number 3 Region: 156-215
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000969
Family Heme-binding PAS domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000042895   Gene: ENSCJAG00000021202   Transcript: ENSCJAT00000055606
Sequence length 887
Comment pep:known chromosome:C_jacchus3.2.1:14:5156302:5330110:1 gene:ENSCJAG00000021202 transcript:ENSCJAT00000055606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAGRFVRDAPFPAEEGRTFDLSEELGRSVTREGTDTTGLNSKPARLCLPLLNCSRKNCI
ENLMDEDEKDRAKRASRNKSEKKRRDQFNVLIKELSSMLPGNTRKMDKTTVLEKVIGFLQ
KHNEVSAQTEICDIQQDWKPSFLSNEEFTQLMLEALDGFIIAVTTDGSIIYVSDSITPLL
GHLPSDVMDQNLLNFLPEQEHSEVYKILSSHMLVTDSPSPEYLKSDSDLEFYCHLLRGSL
NPKEFPTYEYIKFVGNFRSYNNVPSPSCNGFDNTLSRPCRVPLGKEVCFIATVRLATPQF
LKEMCIVDEPLEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHIDDLELLA
RCHQHLMQFGKGKSCCYRFLTKGQQWIWLQTHYYITYHQWNSKPEFIVCTHSVVSYADVR
VERRQELALEDPSSEALHSSALKDKGSSLEPRQHFSALDVGASGLNTSHSPSASSRSSHK
SSHTAMSEPTSTPTKLMAEASTPALPRPATLPQELPVPGLSQAATMPAPLPSPSSCDLAQ
QLLPQTILQSPPAPMAQFSAQFSMFQTIKDQLEQRTRILQANIRWQQEELHKIQEQLCLV
QDSNVQMFLQPPAVSLSFSSTQRPEAQQQLQQRSAAVTQPQLGAGPQLPGQISSAQVTNQ
HLLRESSVISTQGPKPMRSSQLMQSSSRSGSSLVSPFSSTTAVLPTSLNLTTPAPTSQDA
SQCQPSPDFSHDRQLRLLLSQPIQPMMPGSCDARQPSEVSRTGRQVKYAQSQTVFQNPDA
HPTNSSSAPMPVLLMGQAVLHPSFPTSQPSPLQPAQARQQPPQHYLQVQAPTSLHSEQQD
SLLLSTYSQQPGTLGYPAPPPAQPQPLRPSRRVSSLSESSGLQQPPR
Download sequence
Identical sequences F6YMQ4
ENSCJAP00000042895 ENSCJAP00000042895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]