SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000043565 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000043565
Domain Number 1 Region: 84-164
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.3e-23
Family Translational machinery components 0.0051
Further Details:      
 
Domain Number 2 Region: 3-73
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 3.77e-19
Family Ribosomal S5 protein, N-terminal domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000043565   Gene: ENSCJAG00000034916   Transcript: ENSCJAT00000057238
Sequence length 199
Comment pep:known chromosome:C_jacchus3.2.1:X:34267625:34268224:1 gene:ENSCJAG00000034916 transcript:ENSCJAT00000057238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XFFLGASPKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDDNGHVSLGVKCSKEVTTAIHVA
IILAKLSIVPVRRGYWGNKTGKPHTIPCKVTGRCGSVLVCLIPKPRGIGIISVPVPKKLL
MMAGIDDCYTSARGCTATLGNFDKATFDATSKTYSYLTPDLWKETVFTQSPYQEFTDHLV
KTHNRVSMQKTQAPAVATT
Download sequence
Identical sequences F7IPA8
ENSCJAP00000043565 ENSCJAP00000043565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]