SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000043579 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000043579
Domain Number 1 Region: 81-151
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.62e-17
Family HLH, helix-loop-helix DNA-binding domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000043579   Gene: ENSCJAG00000006443   Transcript: ENSCJAT00000054016
Sequence length 247
Comment pep:novel chromosome:C_jacchus3.2.1:19:24783808:24786589:-1 gene:ENSCJAG00000006443 transcript:ENSCJAT00000054016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELYETSPYFYQEPRFYDGENYLPVHLQGFEPPGYERTELSLSPEARGPLEDKGLGTPEH
CPGQCLPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVE
ILRSAIQYIERLQALLSSLNQEERDLRYRGGGGPSQGCPANAALTAPPAVQSGAAHWSSV
PTPGILCSRLTLQTPTTCTPSPPSWTASQWKMCLWLSQMKPCPTEIVCQAGHPCEPPSWP
QMPLLLQ
Download sequence
Identical sequences F7IP79
ENSCJAP00000043579 ENSCJAP00000043579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]