SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000044117 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000044117
Domain Number 1 Region: 447-751
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.97e-86
Family Protein kinases, catalytic subunit 0.000000232
Further Details:      
 
Domain Number 2 Region: 283-411
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.36e-30
Family cAMP-binding domain 0.00085
Further Details:      
 
Domain Number 3 Region: 153-280
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.58e-28
Family cAMP-binding domain 0.00069
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000044117
Domain Number - Region: 29-82
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00837
Family Myosin rod fragments 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000044117   Gene: ENSCJAG00000015083   Transcript: ENSCJAT00000060812
Sequence length 763
Comment pep:novel chromosome:C_jacchus3.2.1:3:113198539:113315763:1 gene:ENSCJAG00000015083 transcript:ENSCJAT00000060812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNGSVKPKHSKHPDGHSGNLTTDALRNKVTELERELRRKDAEIQEREYHLKELREQLSK
QTVAIAELTEELQNKCIQLNKLQDVVHMQGGSPLQASPDKVPLEVHRKTSGLVSLHSRRG
AKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDM
VECMYGRNYQQGSYIIKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNC
TRTASVKAITNVKTWTLDREVFQNIMRRTAQARDEQYRNFLRRSVSLLKNLPEDKLTKII
DCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKA
LISDDVRSANIIAEENDVACLVIDRETFNQTVGTFEELQKYLEGYVANLNRDDEKRHAKR
SMSNWKLSKALSLEMIQLKEKVARFSSSSPFQNLEIIATLGVGGFGRVELVKVKNENVAF
AMKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELW
SILRDRGSFDESTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDAEGYLKLVDFGFAK
KIGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGIDQMMTY
NLILKGIEKIDFPRKITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGL
KARNLPSPLQRELNGPIDHSYFDKYPPEKGMPPDELSGWDKDF
Download sequence
Identical sequences F7GFX3
ENSCJAP00000027848 ENSCJAP00000044117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]