SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000044223 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000044223
Domain Number 1 Region: 1-180
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.36e-35
Family IMD domain 0.0000463
Further Details:      
 
Domain Number 2 Region: 275-354
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000197
Family SH3-domain 0.0000409
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000044223   Gene: ENSCJAG00000031937   Transcript: ENSCJAT00000059991
Sequence length 446
Comment pep:novel chromosome:C_jacchus3.2.1:2:13702130:13730355:1 gene:ENSCJAG00000031937 transcript:ENSCJAT00000059991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GHVLIEISSTHKKLNESLDENFKKFHKEIIHELEKKIELDVKYMNDPAFLNTLRHSTQNN
PKLLHLFILFLEITLDGRRKLTTQRQKAFEHKNAEYVETVTSRQSEIQKFIADGCKEALL
EEKRRFCFLVDKHCSFSNHIHYYHLQSAELLNSKLPRWQETCVDAIKVPEKIMNMIEEIK
TPASTPVSGTPQPSPMVERSSVVRKDYDTLSKCSPKMPPAPSGRAYTSPLIDMFNNPATA
APKSERINNSTDTSEDPSLQRSVSVATGLNMMKKQKVKTIFPHTAGANKTLLSFAQEDVI
TLLIPEEKDGWLYGEHDTSKARGWFPSSYTKLLEENETEAMTLPMPSLSPAPVRSVSTLN
LSESSSVVIPPPDYLECLSMGAAADRRADSARTTSTFKSPASKPETMAPNDANGTAKPPF
LSGENPFATVKLRPTVTNDRSAPVIR
Download sequence
Identical sequences F6UWE9
ENSCJAP00000051574 ENSCJAP00000044223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]