SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000044779 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000044779
Domain Number 1 Region: 113-182
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.13e-24
Family Forkhead DNA-binding domain 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000044779   Gene: ENSCJAG00000032477   Transcript: ENSCJAT00000061515
Sequence length 206
Comment pep:known scaffold:C_jacchus3.2.1:GL286430.1:3683:5386:-1 gene:ENSCJAG00000032477 transcript:ENSCJAT00000061515 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPVLPPSKKSESSGISVSSRLSQCYWGSGFSKALQEDDALDFPLPDTRLEEGTMEDEEL
TNLNWQHKSKNLLKGFGESVLRSVNPVQDLDDDSPVSPAHSDMPYNARQNPNCKPPYSFS
CLKFMAIKDSPTKRLPVKDIYNWILDHFPCFANAPTGGWKNSVRHNLSLNKCLKKVDKER
SQVKKKVKKELRTFSVLIKIKHIYDY
Download sequence
Identical sequences H9KY32
ENSCJAP00000044779 ENSCJAP00000044779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]