SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000045230 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000045230
Domain Number 1 Region: 46-107
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000424
Family Eukaryotic type KH-domain (KH-domain type I) 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000045230   Gene: ENSCJAG00000009947   Transcript: ENSCJAT00000059821
Sequence length 217
Comment pep:novel chromosome:C_jacchus3.2.1:4:71644408:71645474:1 gene:ENSCJAG00000009947 transcript:ENSCJAT00000059821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTPRRFPTLVQLMQPKAMSFEVLGQLPKQFSWFHSEFLKNPKVVRLEVWLVEKIFGRGG
ERIPQVQGLSQILIHVNHLDPSGEAEILIFGRPSYQEDTIKMIVNLADYHRQLQAKGSGK
ALAQDIATQKAETQRSSIEVREAGTQRSVEVREAWTQRSVEVREVGTQGSPVEVREAGTQ
QSLKAASESGTQRSPEAASKARTQRFYVDARDPVTRL
Download sequence
Identical sequences F7FIN3
ENSCJAP00000045230 ENSCJAP00000018291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]