SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000045324 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000045324
Domain Number 1 Region: 229-321
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-17
Family PDZ domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000045324   Gene: ENSCJAG00000033226   Transcript: ENSCJAT00000058132
Sequence length 1701
Comment pep:known chromosome:C_jacchus3.2.1:2:139858189:139883655:-1 gene:ENSCJAG00000033226 transcript:ENSCJAT00000058132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFSSIDRITQNSAEEKEDSGDKTKSTTLPSTETLSWSSEYSEMQQLSTSNSSDTESNRHK
LSSGLLPKLAISTEGEQDEAASCPGDPHEEPGKPALPPEECAQEEPEVTTPASTISSSTL
SVGSFSEHLDQINGRSECVDSTDNSSKPSSEPTSHMARQRLESTEKKKISGKVTKSLSAS
ALSLMIPGDMFAVSPLGSPMSPHSLSSDPSSSRDSSPSRDSSAASSSPHQPIVIHSSGKN
YGFAIRAIRVYVGDSDIYTVHHIVWNVEEGSPACQLGLKAGDLITHINGEPVHGLVHTEV
IELLLKSGNKVSITTTPFENTSIKTGPARRNSYKSRMVRRSKKSKKKESLERRRSLFKKL
AKQPSPLLHTSRSFSCLNRSLSSGESLPGSPTHSLSPRSPTPSYRSTPDFPSGTNSSQSS
SPGSSAPNSPAGSGHIRPSTLHGLAPKLSGQRYRSGRRKSAGNIPLSPARTPSPTPQPTS
PQRSPSPLLGHSLGNSKIAQAFPSKMHSPPTIVRHIVRPKSAEPPRSPLLKRVQSEEKLS
PSYSSDKKHLCSRKHSLEVTQEEVQREQSQREVPLQSLDENVCDAPPLSRARPVEQGCLK
RPVSRKLGRQESVDDLDRDKLKAKVVVKKPDGFPEKPESHQKSHGPGSDLENLALFKLEE
REKKIYPKAVERSSPFENKVALQETPPLGSLLKDALHKQASVRASEGATSDGPASAEHSQ
GGGDFRRAPAPGTLQDGLCHSLDRGMTGKGEGTEKELLRCEKLDSKLANIDYLRKKMSLE
DKEDNLCPVLKPKMTASTHECLPGNQVRPMGGPQEPPPASESRAFVSSTHAAQMSTVSFV
PLKALTGRVDSGAEKPGLVAPESPVRKSPSEYKLEGRTVSCLKPIEGTLDIALLSGPQAS
KTELPSPESVQSPSPGGDVGPSVPPALPSGSGKKSETASARELSPAGLKMNKSYLLEPRF
LPPSRSLQNSPAVSLPCPELKRDRKGPHPTARSPATVVESNPQQREGSSPKHQDHTTDPK
LLTGLGQNLHADLARPRGPLPPEVSPSREKPGLRESAERGPSTARSERSASRADICRDPC
MQLCSPETAKTSDNSKNLPSVGGTHPHFYTQTQAMEKAWAPAGKTNHKDGPDEARPPCRD
DSSLHLAGTPCERELGKGRHGVETKPDVPPARRSLQPPGIESGKSEKLSSFPSVQKDGAK
EPERKEQPLQRHPNSIPPPPLTAKDLPSPAARQPCNSPSHASGRGPGAKPSAPEPSPSPQ
DPPKPVAAHSENSSHKPRPGPDPSPPKSKHPDRSLSSQKPSVGATKGQEPAIQSVGGSSR
EGKGHSRSGPDVFPATPGSQNKASGEVGQGESGPSVRLHTDGGPLDSKPQPASGGRPLEV
SEKPMHLPRPGHPGPSEPADQKLTSVGEKQTLSPKHPKPSTVKDCPALCRQTDKSPSQPA
ATTDRRAERKKCTEALYAPADGDTLEASLAFAHGEARLKGAERPAAGVGKGFPEARGKGP
GPQKPPAEADKPSSVKRSPSATGQSSLRSMALPEKPLNCSSSFPETRPGVREASTACSDT
SSDKAAGGAPEPPASSNRNHRKAQPAGEGRTHMTKSDSLPCFRVSTLALESHHPDPNTMG
GASHRDRALSVTATVGETRGKDPAPAQLPTTRKQNVGRDVTKPSPAPNTDRPISLSNEKD
FVVRQRRGKESLRSSPHKKAL
Download sequence
Identical sequences F6THD7
ENSCJAP00000045324 ENSCJAP00000045324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]