SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000045391 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000045391
Domain Number 1 Region: 437-536
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.82e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000198
Further Details:      
 
Domain Number 2 Region: 579-652
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.07e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0011
Further Details:      
 
Domain Number 3 Region: 646-722
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.94e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000083
Further Details:      
 
Domain Number 4 Region: 1050-1125
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.94e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.000009
Further Details:      
 
Domain Number 5 Region: 146-219
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.61e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000113
Further Details:      
 
Domain Number 6 Region: 345-432
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.48e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000378
Further Details:      
 
Domain Number 7 Region: 972-1048
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.63e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000967
Further Details:      
 
Domain Number 8 Region: 1120-1201
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.04e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000679
Further Details:      
 
Domain Number 9 Region: 728-831
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.72e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0021
Further Details:      
 
Domain Number 10 Region: 866-918,948-971
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000161
Family Eukaryotic type KH-domain (KH-domain type I) 0.0028
Further Details:      
 
Domain Number 11 Region: 290-365
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000672
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 
Domain Number 12 Region: 218-289
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000161
Family Eukaryotic type KH-domain (KH-domain type I) 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000045391
Domain Number - Region: 100-148
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0532
Family Eukaryotic type KH-domain (KH-domain type I) 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000045391   Gene: ENSCJAG00000006152   Transcript: ENSCJAT00000055852
Sequence length 1268
Comment pep:novel chromosome:C_jacchus3.2.1:6:157762078:157850982:-1 gene:ENSCJAG00000006152 transcript:ENSCJAT00000055852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSVAVLTQESFAEHRSGLVPQQIKVATLNSEEESDPPTYKDAFPPLPEKAACLESAQEP
AGAWGNKIRPIKASVITQVFHVPLEERKYKDMNQFGEGEQAKICLEIMQRTGAHLELSLA
KDQGLSIMVSGKLDAVMKARKDIVARLQTQASATVAIPKEHHRFVIGKNGEKLQDLELKT
ATKIQIPRPDDPSNQIKITGTKEGIEKARHEVLLISAEQDKRAVERLEVEKAFHPFIAGP
YNRLVGEIMQETGTRINIPPPVNRTEIVFTGEKEHLAQAAVARIKKIYEEKKKKTTTIAV
EVKKSQHKYVIGPKGNSLQEILERTGVSVEIPPSDSISETVILRGEPEKLGQALTEVYAK
ANSFTVSSVAAPSWLHRFIIGKKGQNLAKITQQMPKVHIEFTEGEDKITLEGPTEDVSVA
QEQIESMVKDLINRMDYVEINIDHKFHRHLIGKSGANINRIKDQYKVSVRIPPDNEKSNL
IRIEGDPQGVQQAKRELLELASRMENERTKDLIIEQRFHRTIIGQKGERIREIRDKFPEV
IINFPDPAQKSDIVQLRGPKNEVEKCTKYMQKMVADLVENSYSISVPIFKQFHKNIIGKG
GANIKKIREESNTKIDLPAENSNSETIVITGKRANCEAARSRILSIQKDLANIAEVEVSI
PAKLHNSLIGTKGRLIRSIMEECGGVHIHFPVEGSGSDTVVIRGPSSDVEKAKKQLLHLA
EEKQTKSFTVDIRAKPEYHKFLIGKGGGKIRKVRDSTGARVIFPAAEDKDQDLITIIGKE
DAVREAQKELEALIQNLDNVVEDYMLVDPRHHRHFVIRRGQVLREIAEEYGGVMVSFPRS
GTQSDKVALKGAKDCVEAAKRRIQEIIEDLEAQVTLECAIPQKFHRSVMGPKGSRIQQIT
RDFSVQIKFPDREENPVHSVEPVVQENGDEAGEGREAKDADPGSPRRCDIIIISGRKEKC
EAAKEALEALVPVTIEVQVPFDLHRYIIGQKGSGIRKMMDEFEVNIHVPAPELQSDIIAI
TGLTANLDRAKAGLLERVKELQAEQEDRALRSFKLSVTVDPKYHPKIIGRKGTVITQIRL
EHDVNIQFPDKDDGSQPQDQITITGYEKNTEAARDAILRIVGELEQMVSEDVPLDHRVHA
RIIGARGKAIRKIMDEFKVDIRFPQSGAPDPNCVTVTGLPENVEEAIDHILNLEEEYLAD
VVDSEALQVYMKPPAHEEAKAPSRGFVVRDAPWTASSSEKAPDMSSSEEFPSFGAQVAPK
TLPWGPKR
Download sequence
Identical sequences F7IB26
ENSCJAP00000045391 ENSCJAP00000011532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]