SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000048087 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000048087
Domain Number 1 Region: 1-287
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 9.42e-88
Family FCH domain 0.0000000000533
Further Details:      
 
Domain Number 2 Region: 533-602
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000171
Family SH3-domain 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000048087
Domain Number - Region: 400-471
Classification Level Classification E-value
Superfamily HR1 repeat 0.00785
Family HR1 repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000048087   Gene: ENSCJAG00000020360   Transcript: ENSCJAT00000061565
Sequence length 611
Comment pep:known chromosome:C_jacchus3.2.1:1:173885029:174040607:-1 gene:ENSCJAG00000020360 transcript:ENSCJAT00000061565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWGTELWDQFDNLEKHTQWGIDILEKYIKFVKERTEIELSYAKQLRNLSKKYQPKKNSK
EEEEYKYTSCKAFISTLNEMNDYAGQHEVISENMASQIIVDLARYVQELKQERKSNFHDG
RKAQQHIETCWKQLESSKRRFERDCKEADRAQQYFEKMDADINVTKADVEKARQQAQIRH
QMAEDSKADYSSILQKFNHEQHEYYHTHIPNIFQKIQEMEERRIVRIGDSMKTYAEVDRQ
VIPIIGKCLDGIVKAAESIDQKNDSQLVIEAYKSGFEPPGDIEFEDYTQPMKRTVSDNSL
SNSRGEGKPDLKFGGKSKGKLWPFIKKNKLMSLLTSPHQPPPPPPASASPSAVPNGPQSP
KQQKEPLSHRFNEFMTSKPKIHCFRSLKRGGATPEDFSNLPPEQRRKKLQQKVDELNKEI
QKEMDQRDAITKMKDVYLKNPQMGDPASLDHKLAEVSQNIEKLRLETQKFEAWLAEVEGR
LPARSEQTRRQSGLYDSQNPPTVNSCAQDRESPDGSYTEEQSQESEVKVLATDFDDEFDD
EEPLPAIGTCKALYMFEGQNEGTISVVEGETLYVIEEDKGDGWTRIRRNEDEEGYVPTSY
VEVYLDKNAKG
Download sequence
Identical sequences F6ZCB9
ENSCJAP00000037865 ENSCJAP00000048087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]