SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000048629 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000048629
Domain Number 1 Region: 195-272
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.26e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000122
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000048629
Domain Number - Region: 105-110
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00115
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000048629   Gene: ENSCJAG00000031492   Transcript: ENSCJAT00000057211
Sequence length 281
Comment pep:novel scaffold:C_jacchus3.2.1:GL286117.1:12499:13820:-1 gene:ENSCJAG00000031492 transcript:ENSCJAT00000057211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPRKAQKQVFIGGKSDRVVECIKIILDLISESPIKGHAQPYDPNFYDETYDYGGFTMMFD
DRRGCPVGFPMRGRGGFDRMPPGRGGRPMPPSRRDYDNMSPRRGPPPPPPGRGGWGGSRA
RNLPLPPPPPPREGDLMAYDRRGRPGDRYDGMVGFSADETWDSAIDTWSPSEWQMAYEPQ
GGSGYDYSYAGGRGSYGDLGGPIITTQVTISKDLAGSIIGKGGQRIKQIRHEGALIKIDE
PLEGSEDRIITITGTQDQIQNAQYLLQNSVKHVKQYSGKFF
Download sequence
Identical sequences H9KYC7
ENSCJAP00000048629 ENSCJAP00000048629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]