SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000048734 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000048734
Domain Number 1 Region: 277-374
Classification Level Classification E-value
Superfamily PDZ domain-like 8.02e-25
Family PDZ domain 0.008
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000048734
Domain Number - Region: 167-205
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.00553
Family Leucine zipper domain 0.0065
Further Details:      
 
Domain Number - Region: 86-190
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0418
Family Myosin rod fragments 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000048734   Gene: ENSCJAG00000004242   Transcript: ENSCJAT00000055896
Sequence length 463
Comment pep:known chromosome:C_jacchus3.2.1:4:117414888:117456115:-1 gene:ENSCJAG00000004242 transcript:ENSCJAT00000055896 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAGGPCPAAAGGGPGGASCSVGVSPGGVSMFRWLEVLEKEFDKAFVDVDLLLGEIDPDQ
ADITYEGRQKMTSLSSCFAQLCHKAQTVSQINHKLEAQLVDLKSELTETQAEKVVLEKEV
HDQLLQLHSIQLQLHAKTGQSVDSGTIKAKLVKLNPDLCERELEANKKEKMKEAQLEAEV
KLLRKENEALRRHIAVLQAEVYGARLAAKYLDKELAGRVQQIQLLGRDMKGPAHDKLWNQ
LEAEIHLHRHKTVIRACRGRNDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGL
GISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQ
RGEIEFEVVYVAPEVDSDDENVEYEDESGHRYRLYLDELEGGGNHGASCKDTSGDIKVLQ
GFNKKAVTDAHENGDLGNASETPLDDSASKLDDLHSLYHNKSY
Download sequence
Identical sequences F6T1D4
ENSCJAP00000007695 ENSCJAP00000048734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]