SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000048868 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000048868
Domain Number 1 Region: 4-124
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.51e-29
Family DBL homology domain (DH-domain) 0.0011
Further Details:      
 
Domain Number 2 Region: 231-338
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.54e-25
Family BAR domain 0.0098
Further Details:      
 
Domain Number 3 Region: 494-556
Classification Level Classification E-value
Superfamily SH3-domain 2.49e-16
Family SH3-domain 0.00043
Further Details:      
 
Domain Number 4 Region: 386-462
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000118
Family SH3-domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000048868   Gene: ENSCJAG00000015747   Transcript: ENSCJAT00000058409
Sequence length 558
Comment pep:novel chromosome:C_jacchus3.2.1:3:88058631:88078700:-1 gene:ENSCJAG00000015747 transcript:ENSCJAT00000058409 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HLSGEVFLQIKGPMEDIYKIYCYHHDEAHSVLESYEKEEELKQHLSHCIQSLKGKPNLLD
MGSLMIKPIQRVMKYPLLLCELRNSTPPSHPDYRALDDAFTAVKDINVNINELKRRKDLV
LKYKKNDEDESLKDKLSKLNIHSISKKSKRVTNHLKILTRGESQRRDSLKKFFSWVSVSG
SRYLHSSIKYHNNLETSLCFYRMENSLPIKGSIKQSVESMARDLPYPQELALASHLQRLT
LAPLSALLSLFPGPHKLIQKRYDKLLDYNSYLQRSAGDESDLAKKEYEALNAQLVEELQT
FNQAARRILSNCLCSFITLLRDLMLGAQQAYSTLVPKRHVILGIFDPHFESCISESMQFL
RAFMTMMTFTSLPHPSHSMPEIPRQTDVHRSKLLSTYSAEELYRAKRKCNATQEYDINLL
EGELVAVIEQKDPLGSTSRWLVDTGMGHVQFSPSNPINIYHRFPLPREEKPSNDNGMLEV
MWLTKAIQPAKKSIADVSSMCTVVAVLAFQARSDHELSLQEYQRVHILRFCDLSGNKEWW
LAEAQGQKGYVPANYLGK
Download sequence
Identical sequences F7B2Y9
ENSCJAP00000028986 ENSCJAP00000048868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]