SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000050035 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000050035
Domain Number 1 Region: 411-607
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.88e-48
Family cAMP-binding domain 0.0000723
Further Details:      
 
Domain Number 2 Region: 165-410
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.79e-37
Family Voltage-gated potassium channels 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000050035   Gene: ENSCJAG00000007236   Transcript: ENSCJAT00000056140
Sequence length 697
Comment pep:known chromosome:C_jacchus3.2.1:14:2456601:2516876:1 gene:ENSCJAG00000007236 transcript:ENSCJAT00000056140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METRGLADSGQGSFTNQGLTSFRRIQKSQPEKVLRKASCGRPLIGWTQWCAEGDEGESEI
ALAGSHRCAEGKSGRLSRLVFSLHRWASRHVPHQEQGPASFPDRFHGAELKEVSSQESNA
QATVDVQEAEDRGRRAWPLAKHNTNTSNNKEEEKKKEKKDGFVMDPSSNLYYRWLTAIAL
PVFYNWCLLICRACFDELQSEYLMLWLVLDYSADVLYVLDMFVRARTGFLEQGLMVSDTD
RLWQHYKATMQFKLDVLSLVPTDLAYLQVGMNFPELRFNRLLKFARLFEFFDRTETRTNY
PNIFRIGNLVLYILIIIHWNACIYFAISKFIGFGTDSWVYPNISIPEHGRLSRKYIYSLY
WSTLTLTTIGETPPPVKDAEYLFVVIDFLVGVLIFATIVGNVGSMISNMNASRAEFQAKI
DSIKQYMQFRKVTKDLETRVIRWFDYLWANKKTVDEKEVLKSLPDKLKAEIAINVHLDTL
KKVRIFQDCEAGLLVELVLKLRPTVFSPGDYICKKGDIGKEMYIINEGKLAVVADDGVTQ
FVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPEAKKA
LEEKGRQILMKDNLIDEELARAGADPKDLEEKVEQLGTSLDILQTRFARLLAEYNATQMK
MKQRLSQLESQMKGGGDSPLANGEVPGDTTKTEDKQQ
Download sequence
Identical sequences F6UU23
ENSCJAP00000050035 ENSCJAP00000013487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]