SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000050191 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000050191
Domain Number 1 Region: 5-291
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.83e-71
Family BAR domain 0.0016
Further Details:      
 
Domain Number 2 Region: 396-577
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.14e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.00000029
Further Details:      
 
Domain Number 3 Region: 699-784
Classification Level Classification E-value
Superfamily SH3-domain 4.2e-16
Family SH3-domain 0.00016
Further Details:      
 
Domain Number 4 Region: 264-367
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000137
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000050191   Gene: ENSCJAG00000002375   Transcript: ENSCJAT00000058968
Sequence length 785
Comment pep:novel chromosome:C_jacchus3.2.1:3:44674508:45033882:-1 gene:ENSCJAG00000002375 transcript:ENSCJAT00000058968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLQPLEFSDCYLDSPWFRERIRAHEAELERTNKFIKELIKDGKNLIAATKSLSVAQRKF
AHSLRDFKFEFIGDAETDDERCIDASLREFSNFLKNLEEQREIMALSVTETLIKPLEKFR
KEQLGAVKEEKKKFDKETEKNYSLIDKHLNLSAKKKDSHLQEADIQVEQNRQHFYELSLE
YVCKLQEIQERKKFEFVEPMLSFFQGMFTFYHQGHELAKDFNHYKMELQINIQNTRNRFE
GTRSEVEELMNKIRQNPKDHKRASQFTAEGYLXXXXXXPAPFGSSWVKHYCMYRKAAKKF
NMIPFEHRSGGKLGDVEVFSLKECTKRHTDSIDRRFCFDIEAADRPGPLTMQAFSEEERK
QWLEALGGKEALSHNFNRAIIPRPEGSAQLDKMGFTIIRKCISAVETRGINDQGLYRVVG
VSSKVQRLLSMLMDVKTCNEVDLENSADWEVKTITSALKQYLRSLPEPLMTYELHGEFIV
PAKSGSPESRVNAVHFLVHKLPEKNKEMLDILVKHLTNVSNHSKQNLMTVANLGVVFGPT
LMRPQEETVAAIMDLKFQNIVVEILIENHEKIFRTPPDTTFPEPTCLSSSPPNAPPRQSK
RQGQRTKRPVAVYNLCLELEDSDNPNPSKEDTPTSSLDSLSSPSPMTAAVPGPPGPDKNH
LLADGGSFGDWASTVPGQTRSSMVQWLNAQSPSTASSNPAVTPPSPESCPFPLSPPATVA
DKPPESISSRKARAVYPCEAEHSSELSFEIGAIFEDVQTSREPGWLEGTLNGKRGLIPQN
YVKLL
Download sequence
Identical sequences F7BQE5
ENSCJAP00000004362 ENSCJAP00000050191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]