SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000000467 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000000467
Domain Number 1 Region: 54-494
Classification Level Classification E-value
Superfamily Sema domain 1.31e-108
Family Sema domain 0.0000758
Further Details:      
 
Domain Number 2 Region: 1336-1465,1661-1849
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.06e-51
Family p120GAP domain-like 0.037
Further Details:      
 
Domain Number 3 Region: 937-1026
Classification Level Classification E-value
Superfamily E set domains 2.8e-18
Family Other IPT/TIG domains 0.056
Further Details:      
 
Domain Number 4 Region: 1025-1128
Classification Level Classification E-value
Superfamily E set domains 3.69e-16
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.054
Further Details:      
 
Domain Number 5 Region: 841-938
Classification Level Classification E-value
Superfamily E set domains 0.000000000000922
Family Other IPT/TIG domains 0.014
Further Details:      
 
Domain Number 6 Region: 492-538
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000615
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 7 Region: 1125-1206
Classification Level Classification E-value
Superfamily E set domains 0.0000000784
Family E-set domains of sugar-utilizing enzymes 0.044
Further Details:      
 
Domain Number 8 Region: 793-827
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000445
Family Plexin repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000000467   Gene: ENSCJAG00000003770   Transcript: ENSCJAT00000000502
Sequence length 1880
Comment pep:known chromosome:C_jacchus3.2.1:19:29982756:30187010:-1 gene:ENSCJAG00000003770 transcript:ENSCJAT00000000502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTRGSRLLTAAPLSMEQRRPWPRGPEVDSRSVVLLSVVWVLLAPPAAGMPQFSTFHSEN
RDWTFNHLTVHRGTGAVYVGAINRVYKLTGNLTIQVAHKTGPEEDNKSCYPPLIVQPCSE
VLTLTNNVNKLLIIDYXVEPSHQDGALPVQRHKTGTMYGIVRSESDDGKLFISTAVDKQD
YFPTLSSRKLPRDHESAMLDYELHSDFVSSLIKIPSDTLALVSHFDIFYIYGFASGSFVY
FLTVQPETPEGVAINSAGDLFYTSRIVRLCKDDPKFHSYVSLPFGCTRAGVEYRLLQAAY
LAKPGDSLAQAFNISSQDDVLFAIFSKGQKQYHHPPDDSALCAFPIRAINLQIKERLQSC
YQGEGNLELNWLLGKDVQCTKAPVPIDDNFCGLDINQPLGGSTPVEGLTLYTTSRDRMTS
VASYVYNGYSVVFVGTKSGKLKKIRADGPPHGGVQYEMVSVLKDGSPILRDMAFSIDQRY
LYIMSERQVTRVPVESCEQYTTCGECLSSGDPHCGWCALHNMCSRKDKCQQAWEPNRFAA
SISQCVSLEVHPSSISVSEHSRLLSLVVSDAPDLSAGIACAFGNLTEVEGQVSGSQVICI
SPGPKDVPVIPLDQDWFGLELQLRSKETGKIFVSTEFKFYNCSAHQLCLSCVNSAFRCHW
CKYRNLCTHDPTTCSFQEGRINVSEDCPQLVPTEEILIPVGEVKPITLKARNLPQPQSGQ
RGYECVLNIQGAIHRVPALRFNSSSVQCQNSSYQYDGMDISNLAVDFAVVWNGNFIIDNP
QDLKVHLYKCAAQRESCGLCLKADRKFECGWCSGERRCTLHQHCTSPSSPWLDWSSHNVK
CSNPQITEILTVSGPPEGGTRVTIHGVNLGLDFSEIAHHVQVAGVPCTPLPGEYIIAEQI
VCEMGHALVGTTSGPVHLCIGECKPEFMTKSHQQYTFVNPSVLSLNPIRGPESGGTMVTI
TGHYLGAGSSVSVYLGNQTCEFYGRSMSEIVCVSPPSSNGLGPVPVSVSVDRARVDNSLQ
FEYIDDPRVQRIEPEWSIASGHTPLTITGFNLDVIQEPRIRVKFNGKESVNVCKVVNTTT
LTCLAPSLTTDYRPGLDTVERPDEFGFVFNNVQSLLIYNDTKFIYYPNPTFELLSPTGVL
DQKPGSPIILKGKNLCPPASGGAKLNYTVLIGETPCAVTVSETQLLCEPPNLTGQHKVMV
HVGGMVFSPGSVSVISDSLLTLPAIVSIAAGGSLLLIIVIIVLIAYKRKSRENDLTLKRL
QMQMDNLESRVALECKEAFAELQTDINELTSDLDRSGIPYLDYRTYAMRVLFPGIEDHPV
LRELEVQGNGQQHVEKALKLFAQLINNKVFLLTFIRTLELQRSFSMRDRGNVASLIMTGL
QGRLEYATDVLKQLLSDLIDKNLENKNHPKLLLRRTESVAEKMLTNWFAFLLHKFLKECA
GEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIEYKTLILNCVNPDNENSPE
IPVKVLNCDTITQVKEKILDAVYKNVPYSQRPRAVDMDLEWRQGRIARVVLQDEDITTKI
EGDWKRLNTLMHYQVSDRSVVALVPKQTSSYNIPASASISRTSISRYDSSFRYTGSPDSL
RSRAPMITPDLESGVKVWHLVKNHDHGDQKEGDRGSKMVSEIYLTRLLATKGTLQKFVDD
LFETLFSTVHRGSALPLAIKYMFDFLDEQADRHSIHDTDVRHTWKSNCLPLRFWVNVIKN
PQFVFDIHKGSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLYAKDIPSYKSWVERY
YADIAKLPAISDQDMNAYLAEQSRLHAVEFNMLSALNEIYSYVSKYSEELIGALEQDEQA
RRQRLAYKVEQLINAMSIES
Download sequence
Identical sequences F7FA30
ENSCJAP00000000467 ENSCJAP00000000467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]