SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000000631 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000000631
Domain Number 1 Region: 463-520
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.19e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 57-118
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.22e-25
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 3 Region: 547-604
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.12e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 687-744
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.83e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 633-688
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.22e-22
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 6 Region: 421-473
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.33e-20
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 7 Region: 729-781
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.17e-18
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 8 Region: 385-436
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.86e-17
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 9 Region: 510-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000701
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 10 Region: 594-626
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000492
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 11 Region: 285-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000551
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000000631
Domain Number - Region: 339-387
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.038
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000000631   Gene: ENSCJAG00000000374   Transcript: ENSCJAT00000000678
Sequence length 791
Comment pep:known chromosome:C_jacchus3.2.1:22:48527395:48555420:-1 gene:ENSCJAG00000000374 transcript:ENSCJAT00000000678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAINPWASWGALMDQSWGMTAVDPWASWALCPQEPAWHMEGSPEEGRRAAGLPAAQEQE
PVTFKDVAVDFTQEEWGQLDLVQRTLYRDVMLETYGHLLSVGNQTAKPEVISLLEQGEEP
WSVEQTCPQRACPEWMRNLESKALIPAQSIFEEEQSHGMKLERYIWDDPWFSRLEVLGCK
DQLEMYHMNQSMAMRQMVFMQKQVLSQRSSEFCEFGAGYSQNFNFVPSQRVSQIEHFYKP
DTHAESWRCNSAIMYADKVTCENTDYDQTAYQSIHPVYPARIQTGDNLFKCTDAVKSFNH
IIHFGDHKGIHTGEKLYEYKECHQIFNQSPSFNEHPRLHVGENQYNYKEYENIFYFSSFM
EHQKIGTVEKAYKYNEWEKVFGYDSFLQHTSTYTAEKPYDYNECGTSFIWSSYLIQHKKS
HTGEKPYECDKCGKVFRNRSALTKHERTHTGIKPYECNKCGKAFSWNSHLIVHKRIHTGE
KPFVCNECGKSFNWNSHLIGHQRTHTGEKPFECTECGKSFSWSSHLIAHMRMHTGEKPFK
CDECEKAFRDYSALSKHERTHSGAKPYKCTECGKSFSWSSHLIAHQRTHTGEKPYNCQEC
GKAFRERSALTKHEIIHSGIKPYECNKCGKSCSQMAHLVRHQRTHTGEKPYECNKCGKSF
SQSCHLVAHRRIHTGEKPYKCNQCERSFNCSSHLIAHRRTHTGEKPYRCNECGKAFNESS
SLIVHLRNHTGEKPYKCNHCEKAFCKNSSLIIHQRMHSGEKRFICSECGKAFSGHSALLQ
HQRNHSEEKPN
Download sequence
Identical sequences F6QL28
ENSCJAP00000000631 XP_008987061.1.60252 ENSCJAP00000000631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]