SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000001145 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000001145
Domain Number 1 Region: 42-155
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.79e-28
Family Spermadhesin, CUB domain 0.00054
Further Details:      
 
Domain Number 2 Region: 247-361
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000929
Family Spermadhesin, CUB domain 0.0033
Further Details:      
 
Domain Number 3 Region: 450-487
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000406
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 4 Region: 204-245
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000038
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 411-448
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000249
Family LDL receptor-like module 0.0028
Further Details:      
 
Domain Number 6 Region: 168-198
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000262
Family LDL receptor-like module 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000001145
Domain Number - Region: 363-409
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00458
Family LDL receptor-like module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000001145   Gene: ENSCJAG00000000662   Transcript: ENSCJAT00000001215
Sequence length 766
Comment pep:novel chromosome:C_jacchus3.2.1:22:27592873:27604783:1 gene:ENSCJAG00000000662 transcript:ENSCJAT00000001215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKRAAPGLEGAPARAQLAVVCLVNIFLTGRLSSAVPALAACSGKLEQHTERRGVIYSPA
WPLNYPPGTNCSWYIQGDRGDMITISFRNFDVEESHQCSLDWLLLGPAAPPRQEAFRLCG
SAIPPAFISARDHVWIFFHSDASSSGQAQGFRLSYIRGKLGQASARQMSRCDNGKCPGPW
QCNTVDECGDGSDEGNCSAPASEPPGLCPGGTFPCSGARSTRCLPVERRCDGLQDCGDGS
DEAGCPDLACGRRLGSFYGSFASPDLFGAARGPSDLHCTWLVDTQESRRVLLQLELRLGY
DDYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAAQGRLTVAYHARARSAGHGFNATYQV
KGYCLPWEQPCGSSSDDDGGSAGDQGCFSEPQRCDGWWHCASGRDEQGCPACPPDQYPCE
GGSGLCYAPADRCNNQKSCPDGADEKNCFSCQPGTFHCGTNLCIFETWRCDGQEDCQDGS
DEHGCLAAVPRKVITAALIGSLVCGLLLVIALGCAFKLYSLRTQEYRAFETQMTRLEAEF
VRREAPPSYGQLIAQGLIPPVEDFPVYSASQASVLQNLRTAMRRQMRRHASRRGPSRRRL
GRLWNRLFHRPRAPRGQITLLTAARPSQTVLGDGLLQPAPEAAPNPPAPLMDTGSPRAAR
DGPPSAPGHVLEVGPSGPPLPLGLQDPECRPMDKDRKACREPLADSPAPVDAPREPCSAQ
DSHPQASTASSTLSPHSPEPLRVCRSPPPHCSPMLEASDDEALLVC
Download sequence
Identical sequences F7G4L4
ENSCJAP00000001145 ENSCJAP00000041981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]