SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000001362 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000001362
Domain Number 1 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.01e-25
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 2 Region: 584-641
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-24
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 3 Region: 640-697
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.03e-24
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 4 Region: 529-585
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.67e-23
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 5 Region: 363-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.17e-22
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 6 Region: 472-529
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.35e-22
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 7 Region: 416-473
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.98e-22
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 8 Region: 686-738
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.23e-20
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 9 Region: 306-359
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000598
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 10 Region: 196-252
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000757
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000001362
Domain Number - Region: 240-286
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0358
Family Classic zinc finger, C2H2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000001362   Gene: ENSCJAG00000000798   Transcript: ENSCJAT00000001445
Sequence length 743
Comment pep:novel chromosome:C_jacchus3.2.1:22:18531024:18590142:1 gene:ENSCJAG00000000798 transcript:ENSCJAT00000001445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLVTFRDVAIEFSLEEWKHLEPAQKNLYWDVMLENYRNLVSLGLTISKPDLITFLEQRK
EPWNVKSAETVATQPDIFLHHNKDLLTEHCTEASFQKVILRRHESCDLENLHIRKRWKRE
ECKGHSGCYDEKTFKYDQFDESSIESLFHQQILSSCAKSNNFDQYKIFTHSSLLNQQQEI
DIWGKHHIYDKPSVFFRPVSTLNGYQDIFIGEKNYQCNNSDKILNQRSSPKNHQENYFLE
KQYKCQEFEKVFLQSMHMQEKQEESYKCDKCEVCTQSLKHTQHQTIPIREDSHRCNKYDK
DNHQSQSSNLRKQVLHNKEKPYKCEKCGDSFNHSLYLTQNQIIPTEEEAYKWKECGKVFN
LNCSLYLTKHQRIHTGENLYKCKACSKSFTRSSNLIVHQRIHTGEKPYKCKECGKAFRCS
SYLTKHKRIHTGEKPYKCKECGKAFNRSSCLTQHQTTHTGEKLYKCKVCSKSYARSSNLI
MHQRVHTGEKPFKCKECGKVFSRSSCLTQHRKIHTGENLYKCKVCAKPFTCFSNLIVHER
IHTGEKPYKCKECGKAFPYSSHLIRHHRTHTGEKPYKCKACSKSFSDSSGLTVHRRTHTG
EKPYTCKECGKAFSYSSDVVQHQRIHTGQRPYKCEECGKAFNYRSYLTTHRRSHTGERPY
KCEVCGKAFNSRSYLTTHRRSHTGERPYKCEECGKAFNYRSYLTTHQRSHTGERPYKCEE
CGKAFNSRSYLTAHQRSHTREKL
Download sequence
Identical sequences F7BJC9
XP_008985833.1.60252 ENSCJAP00000001368 ENSCJAP00000001362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]