SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000001953 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000001953
Domain Number 1 Region: 130-246
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000156
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000214
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000001953
Domain Number - Region: 262-285
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00458
Family Retrovirus zinc finger-like domains 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000001953   Gene: ENSCJAG00000001140   Transcript: ENSCJAT00000002068
Sequence length 602
Comment pep:novel chromosome:C_jacchus3.2.1:8:37378020:37379889:-1 gene:ENSCJAG00000001140 transcript:ENSCJAT00000002068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATGANARPLDFPSQKRQRSCWNKSMEQKTVIAGIPTVIPPDLLENNNKLQLPLEDLTRK
LRMGDLGIPNPKDRSPSPEPFTVTRGKRLNAPEFRTRKKLEEERHNPLTQMVALNTDFKP
PADCKPPVTRVSDKVMIPQVEYSEINFVGLLIPRGNTPKNLEKECNAKIMIRGKGSVKEG
KFGCKDGQRLPEEDEPLKAVTANKMENIKKAVEQIRNVLKQGIETPEYQNHLRKLQVWEF
AGLNGTFRDNRILRPWQSSETCSITNTTVCTKCGGADHIASDCKFQRPRDHQPAQEKARM
NKEYLFLMAELGEAPVPASVDSVSGPATTALASSPRPAAPASNPPPPSLMSTTQSCPPWM
NSGTSESRPYHGMHGGVAGGPGGGPQSFPHPLPSLTGRHGGYPMQHNPYRLPPTWMQPPP
PMNQGPHRPGHHGPPPMDQYLGSTPVGSGVYHLHQGKGMMALPPPSGPLPPSPPPPPPSS
NMASSTPLPWQQNTMTATTSAGTGFIHPKQQQVAATAFPGVPQIQGNPTIVPLPPGVQST
LLPGPPPLPRLLPGSSGMMFALPAPPASPMDPSNFVTMMGMVVAGMPPFGMPPVPPTPPP
QN
Download sequence
Identical sequences F6X335
ENSCJAP00000001953 ENSCJAP00000001953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]