SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000003332 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000003332
Domain Number 1 Region: 534-561,605-687
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000137
Family Anti-sigma factor antagonist SpoIIaa 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000003332   Gene: ENSCJAG00000001864   Transcript: ENSCJAT00000003515
Sequence length 701
Comment pep:known chromosome:C_jacchus3.2.1:3:189936542:189942065:1 gene:ENSCJAG00000001864 transcript:ENSCJAT00000003515 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGESPELLQQGRGLVPVRRQRPAPQGLREMLKARLLRSCSCSVPCAWALVQDLLPATRWL
CQYRPREYLAGDIMSGLVIGIILVPQAIAYSLLAGLQPIYSLYTSFFANLIYFLMGTSRH
VSVGIFSLLCLMVGQVVDRELQLAGFDPSQDGLWPRANSSILNGSAATPDCGRDCYAIRV
ATALTLMTGLYQVLMGVLRLGFVSAYLSQPLLDGFAMGASVTILTSQLKHLLGVRIPRHQ
GLGMVVRTWLSLLLSAGQANVCDVVTSAVCLAVLLAAKELSDRYRRHLRVPLPTELLVIV
VATLVSHFGQLHKHFGSSVAGDIPTGFMAPQVPEPRLMQRVALDAVALALVGAAFSISLA
EMFGRSHGYSVRANQELLAVGCCNVLPAFLHCFATSAALAKSLVKTATGCRTQLSSVVSS
AVVLLVLLALAPLFHDLQRSVLACVIVVSLRGALRKVWDLPRLWRMSPADALVWAGTAAT
CVLVSTETGLLAGIILSLLSLAGRTQRPHAALLARIGDSAFYEDATEFEGLVPEPGVRVF
RFAGPLYYANKDFFLRSLYSLTGLDAGRMAARRKEQGSEVGVGEGGPAQGKDLGPVSSRA
ALVPVAAGFHTVVIDCAPLLFLDAAGVTTLRDLRRDYGALGISLLLACCSPPVRDILSRG
GFLGEGLEDTAEEEQLFLSVHDAVQTAGARHRELEATDACL
Download sequence
Identical sequences F7EMH5
XP_008991979.1.60252 ENSCJAP00000003332 ENSCJAP00000003332 ENSCJAP00000003339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]