SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000003457 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000003457
Domain Number 1 Region: 38-155
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.06e-38
Family Frizzled cysteine-rich domain 0.0000594
Further Details:      
 
Domain Number 2 Region: 172-283
Classification Level Classification E-value
Superfamily TIMP-like 0.00000000000000283
Family Tissue inhibitor of metalloproteinases, TIMP 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000003457   Gene: ENSCJAG00000001920   Transcript: ENSCJAT00000003647
Sequence length 296
Comment pep:known chromosome:C_jacchus3.2.1:3:38714721:38723437:1 gene:ENSCJAG00000001920 transcript:ENSCJAT00000003647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQGPGSLLLLVLAPHCCLGSAHGLFLFGQPDLSYKRSNCKPIPTNLQLCHGIEYQNMRL
PNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSLCVQ
VKDRCAPVMSAFGFPWPDMLDCDRFPQDNDLCIPLASSDHVLPTTTEEAPKVCEACKTKN
DDDNDIMETLCKNDFALKIKVKEITYINGDTKIILETKSKTIYKLNGVSEKDLKKSVLWL
KDSLQCTCEEMNDINAPYLVMGQKQGGELVITSVKRWQKGQREFKRISRSIRKLQC
Download sequence
Identical sequences A0A2K6TBH2 F7E410
ENSCJAP00000003457 ENSCJAP00000047561 ENSCJAP00000003457 XP_002745425.1.60252 XP_003928010.1.74449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]