SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000003817 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000003817
Domain Number 1 Region: 150-209
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.69e-17
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 244-287
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000217
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 3 Region: 273-315
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000272
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 4 Region: 198-227
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000406
Family Classic zinc finger, C2H2 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000003817   Gene: ENSCJAG00000002097   Transcript: ENSCJAT00000004021
Sequence length 732
Comment pep:known chromosome:C_jacchus3.2.1:7:72223744:72274359:-1 gene:ENSCJAG00000002097 transcript:ENSCJAT00000004021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEHSPDNNIIYFKAEEDELTPDDKMLRFVDKNGLMPSSSGTVYDRTTVLIEQDPGTLED
DDDDGQCGEHLPFLVGGEEGFHLIDHEAMSQGYVQHIISPDQIHLTINPGSTPMPRNIEG
ATLTLQSECPETKRKEVKRYQCTFEGCPRTYSTAGNLRTHQKTHRGEYTFVCNQEGCGKA
FLTSYSLRIHVRVHTKEKPFECDVQGCEKAFNTLYRLKAHQRLHTGKTFNCESEGCSKYF
TTLSDLRKHIRTHTGEKPFRCDHDGCGKAFAASHHLKTHVRTHTGERPFFCPSNGCEKTF
STQYSLKSHMKGHDNKGHSYSALPQHNGLEDTNHSLCLSDLSLLSTDSELRENSNTTQGQ
DLSTISPAIIFESVFQNSDDTAIQEDPQQTASLIESFNGDAESVSDVPPSTGNSASLSLL
LVLQPGLSEPPQPLLPASAPSAPSLEPGSQQAAFGNPPALLQPPEVPVPHSTQFAANHQE
FLPHPQAPQPIVPGLSVVAGASPPQSTTESLPAMVQTLPLGANSVLTNNPTISITPTPST
AILQSSLVMGEQNLQWILNGATSSPQNQEQIQQASKVEKVFYTTAVPVASRPGNSLDSFL
ITVVPVIIIKTRKSVACRDSAKERASSRRKGYSPPTPPQPSPQAPDGPSLQLPVQTFSSA
PVPRSPSSTMPFSCEQSRQAEAPSDPQTETLSAMDVLQFLSLQNMDTPSNLIPLEALLQR
EEEMGLTSSFSK
Download sequence
Identical sequences F7GZ48
ENSCJAP00000003817 ENSCJAP00000003817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]