SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000004542 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000004542
Domain Number 1 Region: 323-424
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 9.11e-27
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.000049
Further Details:      
 
Domain Number 2 Region: 3-240
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.23e-21
Family G proteins 0.00000584
Further Details:      
 
Domain Number 3 Region: 227-319
Classification Level Classification E-value
Superfamily Translation proteins 0.00000000193
Family Elongation factors 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000004542   Gene: ENSCJAG00000002497   Transcript: ENSCJAT00000004789
Sequence length 446
Comment pep:novel chromosome:C_jacchus3.2.1:9:86946590:86948352:-1 gene:ENSCJAG00000002497 transcript:ENSCJAT00000004789 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKEKTHIDIVIIGHIDAKSITTGHLINKCGGSNNNKNTSKNLRRKLLRWKSVPSHAWVS
DKMKAELERGMTIDISPWKFDVSEHRDFIINMNPGISQANSAVLIAADVGKFEGSISKNG
QPHEHGVLAYTLGMKQPIVGANKMNSTGHPSEEEIAKNDSTYIKQIGKPRHSSICAISGL
NSDIMLEPRANMPWFKGWKVTHKHGSSGNTLLETLDCIIPPTPVTKKPPCLPLQDVYKTD
GSCKIYCRAPGQGSMVQGRAREVAPSCSDTDVDSVEMYHHEGLIEALPGDNVGFSVKNVS
VKDVCCGRVASDRKNDPPMEIACFIAQVIILSLLGHTGADHAPLLNCHTVHIACKFAELK
EKIDRCYSNKLEDSPKFLKSDDVAIVDMVPCKPTCVENFLDDPILDRFAVCEMKQTAAVD
VIKTGDKKTAGDGKVIKSVQKPQKAK
Download sequence
Identical sequences F7C518
ENSCJAP00000004542 ENSCJAP00000004542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]