SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000005583 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000005583
Domain Number 1 Region: 491-547
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.28e-18
Family Classic zinc finger, C2H2 0.0016
Further Details:      
 
Domain Number 2 Region: 540-567
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000085
Family Classic zinc finger, C2H2 0.0022
Further Details:      
 
Domain Number 3 Region: 446-478
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000015
Family Classic zinc finger, C2H2 0.0017
Further Details:      
 
Domain Number 4 Region: 415-444
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000293
Family Classic zinc finger, C2H2 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000005583   Gene: ENSCJAG00000003076   Transcript: ENSCJAT00000005890
Sequence length 688
Comment pep:novel scaffold:C_jacchus3.2.1:GL285225.1:433:2550:1 gene:ENSCJAG00000003076 transcript:ENSCJAT00000005890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METSALATFSEKQEAKSGLLEAAGFPDLGKKASPLVAAAAAVVVAQGVLQHLLPRFHAPL
PIDMRHQEGRYHYEPHSVHGVHGPPALSGSPVISDISLIRLSPHPAGPGDSPFNAPHLYV
NPHMKHYLRSVHSSPTLSMISAARGLSTAEVAQEHLERGLFGLPAPGTTPSDYYHQMTLM
AGHPAPYGDLLMQSGGAASAPHLHDYLNPVDVSRFSKPRVTPRLSRKRTLSISPLSDASL
DLQRMIRTSPNSLVAYINNSRSSSAASGSFGHLSEGTLSPAFTFPHPINPVAYQQILSQQ
RGLGSAFGHTPPLIQPSPTFLAQQPMALTSVNATPTQLSSSSNCLSDNQNKQSSESAVSS
TINPVVKRSKVKTEPEGLRPASPLALTQGQEQLADLKEDLDRNDCQEAEVVIYETNCHWE
DCTKEYDTREQLVHHINNEHIHGEKKEFVCCWQTCTREQKPFKAQYMLVVHKGRHTGEKP
HKCTFEGCLKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRIHSNEK
PYICKFPGCTKRYTDSSSLLKHVKTVHDPDAHVTKKRNDVHLGTPLLKENGDSEACAEPG
GRGSEDSAEASSTSQAVEDCLHVRANKTESSRLCQSSPGAQSSCSSEPSPLGSAPNNDSG
VEMSGTGPRSLGDLTELDDTPPGADASA
Download sequence
Identical sequences H9KVZ0
ENSCJAP00000005583 ENSCJAP00000005583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]