SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000006678 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000006678
Domain Number 1 Region: 218-381,414-476
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.02e-38
Family Voltage-gated potassium channels 0.0034
Further Details:      
 
Domain Number 2 Region: 481-663
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.23e-36
Family cAMP-binding domain 0.00093
Further Details:      
 
Domain Number 3 Region: 39-135
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.28e-21
Family Flavin-binding PAS domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000006678   Gene: ENSCJAG00000003681   Transcript: ENSCJAT00000007051
Sequence length 1106
Comment pep:novel chromosome:C_jacchus3.2.1:17:50268358:50322422:1 gene:ENSCJAG00000003681 transcript:ENSCJAT00000007051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVMKGLLAPQNTFLDTIATRFDGTHSNFILANAQVAKGFPIVYCSDGFCELAGFARTEV
MQKSCSCKFLFGVETNEQLMLQIEKSLEEKTEFKGEIMFYKKNGSPFWCLLDIVPIKNEK
GDVVLFLASFKDITDTKVKITPEDKKEDKVKGRSRAGTHFDSARRRSRAVLYHISGHLQR
REKNKLKINNNVFVDKPAFPEYKVSDAKKSKFILLHFSTFKAGWDWLILLATFYVAVTVP
YNVCFIGNDDLSTTRSTTVSDIAVEILFIIDIILNFRTTYVSKSGQVIFEARSICIHYVT
TWFIIDLIAALPFDLLYAFNVTVVSLVHLLKTVRLLRLLRLLQKLDRYSQHSTIVLTLLM
SMFALLAHWMACIWYVIGKMEREDNSLLKWEVGWLHELGKRLESPYYGNNTLGGPSIRSA
YIAALYFTLSSLTSVGFGNVSANTDAEKIFSICTMLIGALMHALVFGNVTAIIQRMYSRW
SLYHTRTKDLKDFIRVHHLPQQLKQRMLEYFQTTWSVNNGIDSNELLKDFPDELRSDITM
HLNKEILQLSLFECASRGCLRSLSLHIKTSFCAPGEYLLRQGDALQAIYFVCSGSMEVLK
DSMVLAILGKGDLIGANLSIKDQVIKTNADVKALTYCDLQCIILKGLFEVLDLYPEYAHK
FMEDIQHDLTYNLREGHESDVISRLSNKSSVSQSEPKGNGSINKRLPSIVEDEEEEEEGE
EEETASLSPICTRGSSRHKKVGSNKTYLGLSLKQLASGTVPFHSPIRVSRSNSPKTKQET
DTPNHSKTKQKNLKLQLSTLNSAGPPDLSPRIVDGIEDGNSSEESQTFDFGSERIRPEPR
ISPPLGDPDTGAAVLFIKAEETKQQINKLNSEVTTLTQEVSQLGKDMRNVIQLLENVLSP
QQPSRICSLHSTSVCPSRESLQTRMSWSTHQPCLHLQTGGTAYTQAQLCSSNITSDIWRV
DPSSVGSSPQRTGAHEQNPADSELYHSPSLDYSPSHYQVVQEGHLQFLRCISPHSDTTLT
PLQSISATLSSSVCSSSETSLHLVLPSRSEEGSFSQGTVSSFSLENLPGSWNQEGMASAS
TKPLENFPLEVVTSTAEVKDNKAINV
Download sequence
Identical sequences F7F3H8
ENSCJAP00000006678 XP_002759689.1.60252 ENSCJAP00000006710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]