SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000008837 from Callithrix jacchus 69_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000008837
Domain Number 1 Region: 649-844
Classification Level Classification E-value
Superfamily Sec7 domain 1.7e-76
Family Sec7 domain 0.00000156
Further Details:      
 
Domain Number 2 Region: 406-589,1102-1114,1148-1492
Classification Level Classification E-value
Superfamily ARM repeat 2.12e-26
Family HspBP1 domain 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000008837   Gene: ENSCJAG00000004730   Transcript: ENSCJAT00000009341
Sequence length 1809
Comment pep:known chromosome:C_jacchus3.2.1:16:19550578:19667026:-1 gene:ENSCJAG00000004730 transcript:ENSCJAT00000009341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SEEIKAETEKQSPPHGEAKAGSSTLPPVKSKTNFIEADKYFLPFELACQSKCPRIVSTSL
DCLQKLIAYGHLTGNAPDSTTPGKKLIDRIIETICGCFQGPQTDEGVQLQIIKALLTAVT
SQHIEIHEGTVLQAVRTCYNIYLASKNLINQTTAKATLTQMLNVIFARMENQALQEAKQM
EKERHRQHHHLLQSPVSHHEPESPQLRYLPPQTVDHISQEHEGHLDPHTNDVDKSLQDDT
EPENGSDISSAENEQTEADQATAAETLSKNDILYDGENHDCEEKPQDIVQNIVEEMVNIV
VGDMGEGTTINASADGNIGAIEDGSDSENIQANGIPGTPISVAYTPSLPDDRLSVSSNDT
QESGNSSGPSPGAKFSHILQKDAFLVFRSLCKLSMKPLSDGPPDPKSHELRSKILSLQLL
LSILQNAGPVFRTNEMFINAIKQYLCVALSKNGVSSVPEVFELSLSIFLTLLSNFKTHLK
MQIEVFFKEIFLYILETSTSSFDHKWMVIQTLTRICADAQSVVDIYVNYDCDLNAANIFE
RLVNDLSKIAQGRGSQELGMSNVQELSLRKKGLECLVSILKCMVEWSKDQYVNPNSQTTL
GQEKPSEQEMSEIKHPESINRYGSLNSLESTSSSGIGSYSTQMSGTDNPEQFEVLKQQKE
IIEQGIDLFNKKPKRGIQYLQEQGMLGTTPEDIAQFLHQEERLDSTQVGEFLGDNDKFNK
EVMYAYVDQHDFSGKDFVSALRMFLEGFRLPGEAQKIDRLMEKFAARYLECNQGQTLFAS
ADTAYVLAYSIIMLTTDLHSPQVKNKMTKEQYIKMNRGINDSKDLPEEYLSAIYNEIAGK
KISMKETKELTIPTKSSKQNVASEKQRRLLYNLEMEQMAKTAKALMEAVSHVQAPFTSAT
HLEHVRPMFKLAWTPFLAAFSVGLQDCDDTEVASLCLEGIRCAIRIACIFSIQLERDAYV
QALARFTLLTVSSGITEMKQKNIDTIKTLITVAHTDGNYLGNSWHEILKCISQLELAQLI
GTGVKPRYISGTVRGREGSLTGTKDQAPDEFAGLGLVGGNVDWKQIASIQESIGETSSQS
VVVAVDRIFTGSTRLDGNAIVDFVRWLCAVSMDELLSTTHPRMFSLQKIVEISYYNMGRI
RLQWSRIWEVIGDHFNKVGCNPNEDVAIFAVDSLRQLSMKFLEKGELANFRFQKDFLRPF
EHIMKRNRSPTIRDMVVRCIAQMVNSQAANIRSGWKNIFSVFHLAASDQDESIVELAFQT
TGHIVTLVFEKHFPATIDSFQDAVKCLSEFACNAAFPDTSMEAIRLIRHCAKYVSDRPQA
FKEYTSDDMNVAPEDRVWVRGWFPILFELSCIINRCKLDVRTRGLTVMFEIMKTYGHTYE
KHWWQDLFRIVFRIFDNMKLPEQQTEKAEWMTTTCNHALYAICDVFTQYLEVLSDVLLDD
IFAQLYWCVQQDNEQLARSGTNCLENVVILNGEKFTLEIWDKTCNCTLDIFKTTIPHALL
TWRPTSGETAPLPPSPVSEKPLDTISQKSVDIHDSIQPRSVDNRPQAPLVSASAVNEEIS
KIKSTAKFPEQKLFAALLIKCVVQLELIQTIDNIVFFPATSKKEDAENLAAAQRDAVDFD
VRVDTQDQGMYRFLTSQQLFKLLDCLLESHRFAKAFNSNNEQRTALWKAGFKGKSKPNLL
KQETSSLACGLRILFRMYMDESRISAWEEVQQRLLNVCSEALSYFLTLTSESHREAWTNL
LLLFLTKVLKISDNRFKAHASFYYPLLCEIMQFDLIPELRAVLRRFFLRIGVVFQISQPP
EQELGINKQ
Download sequence
Identical sequences F7IHI7
ENSCJAP00000008837 ENSCJAP00000008837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]